Entry information : LuPrx49(Lus10008581|PACid:23180074)
Entry ID 12162
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx49(Lus10008581|PACid:23180074)
Name LuPrx49(Lus10008581|PACid:23180074)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx49
start..stop
S start..stop
LuPrx63 451 2e-161 9..307 25..325
LuPrx168 437 5e-156 7..307 23..321
LuPrx64 436 2e-155 8..307 24..321
PpePrx55 422 1e-149 7..307 32..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5804..5965 162 N° 2 5504..5698 195 N° 3 4851..5417 567  
complement(join(4851..5417,5504..5698,5804..5965))


exon

Literature and cross-references LuPrx49(Lus10008581|PACid:23180074)
DNA ref. Phytozome 12:   scaffold1686 (5965..4851)
Protein sequence: LuPrx49(Lus10008581|PACid:23180074)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308
PWM (Da):   %s   33524.24  
PI (pH):   %s   10.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAVAQAQLSPTFYKKTCPNPLPAIRRIVRQAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTKNFTGEKTAGANANSVRGFDVIDKIKSELNKVCKGNVVSCSDILAVAARDSVYILGGPSYFYRLPLGRRDSRTASLNAANNNLPAPFFSFSQLVSSFQSQGLNTKDLIALSGGHTIGQARCTLFRTRVHNDTNIDRNFASSVKRTCPSVTGKGDNNAQPLDQSPARFDTQYYRALVQKKGLLHSDQELFGTGNKASDALVRLYSNNPSKFAKDFGVSMIKMGGIKVLTGTRGEVRKNCRRIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGTCGCACAAGCACAACTGTCTCCTACTTTCTACAAGAAAACTTGCCCCAACCCTCTTCCCGCCATTAGACGGATCGTTAGGCAAGCCATCCAGAAGGAGGCCCGAATGGGC
GCCTCCTTGCTCCGGTTGCATTTCCACGATTGCTTCGTCAAT
GTACGTAAGCTTGATCATTAGTCGAGGTATATAGTTCACTATATATATGGTGAATGCTACGGTGACTATGTATTTAAT
ATATCGAATTTTGTAACTATGATATAGGGGTGTGACGGGTCGGTGCTGCTGGATGACACTAAGAATTTTACGGGAGAGAAGACGGCTGGGGCGAATGCGAACTCGGTTAGAGGGTTTGAT
GTGATTGATAAGATCAAGTCGGAACTTAACAAAGTTTGTAAGGGCAATGTCGTCTCTTGCTCCGACATTCTGGCTGTGGCTGCTCGTGACTCGGTTTATATT
GTAAGCACACTCACTATT
CTTTTATCGTTGCATTGAGTGTGATGAATTCGAACTCGTGAACTTACATGTTTAATTTTGTGTTACAGCTAGGAGGACCTTCGTACTTCTATCGGCTCCCCTTAGGAAGGCGTGACAGTA
GGACCGCGAGCCTAAACGCAGCAAACAACAACCTCCCAGCACCATTCTTCAGCTTCTCCCAGCTCGTCTCGAGCTTCCAGTCCCAAGGCCTGAACACGAAGGACCTCATTGCACTCTCTG
GGGGGCACACTATCGGACAGGCTAGGTGCACCCTGTTCCGTACCAGGGTACACAACGACACCAACATAGACCGCAACTTCGCCTCCTCCGTGAAGCGAACTTGCCCCTCTGTGACGGGCA
AAGGGGACAACAACGCCCAACCACTTGACCAGAGCCCTGCAAGGTTCGACACACAGTACTATAGGGCTCTGGTCCAGAAGAAGGGGTTGTTACATTCAGACCAGGAGCTGTTCGGGACAG
GGAATAAAGCCAGTGATGCTTTGGTTCGGTTGTATAGCAACAACCCGAGCAAATTCGCCAAGGATTTCGGAGTTTCGATGATCAAGATGGGGGGTATTAAGGTTCTCACTGGGACGAGAG
GGGAGGTTAGGAAGAACTGCCGCAGGATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGTCGCACAAGCACAACTGTCTCCTACTTTCTACAAGAAAACTTGCCCCAACCCTCTTCCCGCCATTAGACGGATCGTTAGGCAAGCCATCCAGAAGGAGGCCCGAATGGGC
GCCTCCTTGCTCCGGTTGCATTTCCACGATTGCTTCGTCAAT
GGGTGTGACGGGTCGGTGCTGCTGGATGACACTAAGAATTTTACGGGAGAGAAGACGGCTGGGGCGAATGCGAACTCG
GTTAGAGGGTTTGATGTGATTGATAAGATCAAGTCGGAACTTAACAAAGTTTGTAAGGGCAATGTCGTCTCTTGCTCCGACATTCTGGCTGTGGCTGCTCGTGACTCGGTTTATATT
CTA
GGAGGACCTTCGTACTTCTATCGGCTCCCCTTAGGAAGGCGTGACAGTAGGACCGCGAGCCTAAACGCAGCAAACAACAACCTCCCAGCACCATTCTTCAGCTTCTCCCAGCTCGTCTCG
AGCTTCCAGTCCCAAGGCCTGAACACGAAGGACCTCATTGCACTCTCTGGGGGGCACACTATCGGACAGGCTAGGTGCACCCTGTTCCGTACCAGGGTACACAACGACACCAACATAGAC
CGCAACTTCGCCTCCTCCGTGAAGCGAACTTGCCCCTCTGTGACGGGCAAAGGGGACAACAACGCCCAACCACTTGACCAGAGCCCTGCAAGGTTCGACACACAGTACTATAGGGCTCTG
GTCCAGAAGAAGGGGTTGTTACATTCAGACCAGGAGCTGTTCGGGACAGGGAATAAAGCCAGTGATGCTTTGGTTCGGTTGTATAGCAACAACCCGAGCAAATTCGCCAAGGATTTCGGA
GTTTCGATGATCAAGATGGGGGGTATTAAGGTTCTCACTGGGACGAGAGGGGAGGTTAGGAAGAACTGCCGCAGGATTAACTAA

Retrieve as FASTA