Entry information : LuPrx52(Lus10009090|PACid:23172420)
Entry ID 12163
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx52(Lus10009090|PACid:23172420)
Name LuPrx52(Lus10009090|PACid:23172420)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx52
start..stop
S start..stop
LuPrx134 343 3.64e-120 1..203 1..204
RcPrx52 222 7.01e-73 33..203 24..195
MePrx20 215 5.4e-70 33..203 36..207
NnPrx84 214 1.13e-69 14..203 12..209
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12163' 'join(206993..207225,207470..207662,207764..207929,208402..208439)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 206993..207225 231 N° 2 207470..207662 191 N° 3 207764..207929 164 N° 4 208402..208439 36
join(206993..207225,207470..207662,207764..207929,208402..208439)


exon

Literature and cross-references LuPrx52(Lus10009090|PACid:23172420)
DNA ref. Phytozome 12:   scaffold491 (206993..208439)
Protein sequence: LuPrx52(Lus10009090|PACid:23172420)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   209
PWM (Da):   %s   22044.38 Transmb domain:   %s   o10-32i
PI (pH):   %s   4.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPSLINHSFTTLLLLTSFLAVGTSISLVLGLSLNSYDQTCPLATSKIKEIVNQAVQTERRMGASLIRLHFHDCLSICHGLVLLDEVAPSLVGEKTAAPNDNSLRGFDVIDNIKAALES
MCPGVVSCSDILTVAARDAVVALGGPSWQVLLGRKDSTNANFSSALENLPSPFIDSNDLAAAFALKGFTSQEMVTLSGTLEIGGLVMKQ*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 3' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCAAGTCTTATTAACCACAGTTTTACCACACTACTTCTCCTGACTAGTTTCCTTGCCGTAGGGACCTCGATCTCTTTGGTGCTCGGCTTATCTCTCAATTCCTACGATCAG
ACGTGCCCTCTCGCCACCTCCAAGATCAAAGAGATCGTCAACCAAGCAGTCCAGACTGAGAGGCGCATGGGTGCCTCTCTCATTCGTCTTCACTTCCACGATTGCTTGTCAAT
ATGTAAG
TAAACTAATTATTTAAACTACGTATTAATTAATTTTATATATAATCACTTGTGAATTTAGAACGACTTATGATATGATATATCAGAACCTTTGGTTGACAAAATATCCAGATTTCTGGAT
GACTAGACCCTAATAGTCCCCATTCTTATATGTTGAAACTATACACACGTCATACTCTTCATAAATTGTTGTCTAGTTAAATGGATATATCGATAACGTAAGTCATGTGTGTTGCAGAGA
TGTCATGGATTGGTACTGCTAGACGAAGTGGCACCAAGTTTGGTAGGAGAGAAGACTGCGGCGCCAAACGACAACTCCTTGAGAGGGTTCGATGTGATAGACAACATCAAAGCGGCGTTG
GAAAGTATGTGTCCAGGAGTTGTGTCCTGTTCTGATATCTTGACGGTGGCGGCCCGCGATGCCGTTGTTGCT
CTGTAAGTTATTACTTATGTATAATATAATGTTTTAATTGATTAATTA
CACATAATAAATGTAACAAATTACAATGTGGACAGTGTTTGAATGAATTGTGTAGCTTGGAGGGCCAAGTTGGCAAGTTCTACTTGGAAGAAAAGACTCCACCAACGCGAATTTCTCCAG
CGCACTCGAAAACCTCCCTTCTCCGTTTATAGATTCCAACGACCTCGCCGCTGCCTTTGCCCTCAAGGGCTTTACATCCCAGGAAATGGTCACTCTCTCTG
TGGTTCGTATATACCATCT
TTATACATGATTTTCGTACTAATTTCTTGTGCTAGTGGATTAACGAAACGACTAGGGTTCAAGGTTAGTGTGGTCATTTCACTTATTGTTTAATAGTGTTTTTGCCCTTTTACTTTACCA
TGTTAACAACAAACTTTTACTATTAAATATTATTTTTACCCCTTCTATTTTACTACTTTACCAGTTTGCTAAACGTCTCCATCTATTACTCTATAAGTTATCTTGTCGTTATTTTTAGCC
TAATCAACATTGCCACATCATTCAGAATGACATGTGATAAGGCTAGAATTTGTAGCAATTATCTATCCTTATATGCATGCTTTTTGAGTGATTATTAGTTTGTTCGAGCTTCATTCTTGT
GTGATTTCGTGTTTTGGCATTATGTGCCTAGACCCGTTCATTTGGACCGTTTCGGTCCATTTGATGTGTTTCTTTGTAGTATTTGTTGTCCACAGGTACTCTAGAGATAGGTGGTCTTGT
TATGAAGCAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCAAGTCTTATTAACCACAGTTTTACCACACTACTTCTCCTGACTAGTTTCCTTGCCGTAGGGACCTCGATCTCTTTGGTGCTCGGCTTATCTCTCAATTCCTACGATCAG
ACGTGCCCTCTCGCCACCTCCAAGATCAAAGAGATCGTCAACCAAGCAGTCCAGACTGAGAGGCGCATGGGTGCCTCTCTCATTCGTCTTCACTTCCACGATTGCTTGTCAAT
ATGTCAT
GGATTGGTACTGCTAGACGAAGTGGCACCAAGTTTGGTAGGAGAGAAGACTGCGGCGCCAAACGACAACTCCTTGAGAGGGTTCGATGTGATAGACAACATCAAAGCGGCGTTGGAAAGT
ATGTGTCCAGGAGTTGTGTCCTGTTCTGATATCTTGACGGTGGCGGCCCGCGATGCCGTTGTTGCT
CTTGGAGGGCCAAGTTGGCAAGTTCTACTTGGAAGAAAAGACTCCACCAACGCG
AATTTCTCCAGCGCACTCGAAAACCTCCCTTCTCCGTTTATAGATTCCAACGACCTCGCCGCTGCCTTTGCCCTCAAGGGCTTTACATCCCAGGAAATGGTCACTCTCTCTG
GTACTCTA
GAGATAGGTGGTCTTGTTATGAAGCAATGA

Retrieve as FASTA