Entry information : LuPrx63(Lus10009935|PACid:23150081)
Entry ID 12172
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx63(Lus10009935|PACid:23150081)
Name LuPrx63(Lus10009935|PACid:23150081)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx63
start..stop
S start..stop
LuPrx49 463 6e-166 17..325 1..307
PtPrx39 446 6e-159 1..325 1..319
LuPrx168 442 2e-157 1..325 1..321
LuPrx64 435 7e-155 1..325 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 205424..205633 210 N° 2 205709..205903 195 N° 3 206008..206580 573  
join(205424..205633,205709..205903,206008..206580)


exon

Literature and cross-references LuPrx63(Lus10009935|PACid:23150081)
DNA ref. Phytozome 12:   scaffold200 (205424..206580)
Protein sequence: LuPrx63(Lus10009935|PACid:23150081)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   35160.65 (32756.4) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.31 (9.31) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALRDFSLAVAFLMAVAAAAQAQLTPDFYKTSCPQALPAIRKIVRQEIKKETRMGASLLRLHFHDCFVNGCDGSILLDDTANFTGEKTAAPNVNSVRGFEVIDKIKSEVNRKCKANVVSCADILAVAARDSVSIMGGQSYFYQVPLGRRDARTASRAAANNSLPPPTFNFSQLISNFQSHGLNLTDLVALSGGHTIGVSRCVNFRNRIYNETSNSIQPQFASSLQRNCPAAAGSGDNNTQGLDQTPEGFDVQYFRSLIQSRGLLHSDQELFGKGNSASDVLVRMYGSNPGRFAADFAASMVKMGNMKPLTGNNGEIRKNCRIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTGCGGGACTTCTCGCTTGCGGTTGCTTTTCTGATGGCAGTTGCAGCAGCAGCACAAGCACAACTCACTCCTGATTTCTACAAAACAAGTTGCCCCCAGGCCCTCCCTGCA
ATTCGAAAGATTGTTAGGCAAGAAATAAAAAAGGAGACTCGAATGGGCGCTTCCCTCCTCCGATTGCACTTCCACGACTGCTTTGTCAAT
GTAAGTTCACTACTTTCTGTTTTGTTTTTC
AAATTCACTGTCTAATGTGAAATAACTCAACAAAATGGGTTGCAGGGTTGTGACGGCTCCATACTACTGGACGACACTGCCAATTTTACCGGAGAGAAGACGGCAGCTCCTAACGTAAAC
TCCGTGAGAGGGTTTGAAGTTATCGACAAAATCAAGTCGGAAGTTAACAGAAAATGCAAGGCTAATGTCGTCTCCTGCGCTGACATCTTAGCCGTTGCTGCTCGTGACTCTGTCTCGATC
GTAACCCAACCCAACCTAACTCATTTCATTTTCCTATACCTCAGTAAACGTCGTCGTATTGGTAACTAAACTTTCGGTTTTTTACATTTATAAAATCTTTACAGATGGGAGGTCAAAGTT
ACTTCTACCAAGTTCCCTTAGGAAGAAGAGACGCCAGAACAGCCAGCCGCGCAGCCGCGAACAACAGCCTCCCGCCGCCGACGTTCAACTTCTCGCAGCTAATCTCCAACTTCCAATCCC
ACGGCCTCAACCTCACCGATCTCGTGGCGCTTTCGGGAGGACACACAATCGGCGTGTCTCGCTGCGTCAATTTCCGAAACCGGATCTACAACGAGACGTCCAACAGCATTCAGCCCCAAT
TCGCTTCCTCTTTGCAGCGTAACTGCCCGGCCGCCGCCGGAAGCGGGGACAACAACACCCAGGGTCTCGACCAGACTCCAGAGGGATTCGACGTCCAGTACTTCAGGTCGTTGATTCAGT
CGAGGGGGCTCCTGCATTCCGATCAGGAGCTGTTCGGGAAAGGTAATAGTGCGAGCGACGTGCTGGTGAGGATGTACGGCAGTAATCCGGGGAGGTTCGCGGCGGATTTTGCAGCGTCGA
TGGTTAAGATGGGGAATATGAAGCCACTTACCGGGAATAATGGGGAGATCAGAAAGAATTGTCGCATCGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTGCGGGACTTCTCGCTTGCGGTTGCTTTTCTGATGGCAGTTGCAGCAGCAGCACAAGCACAACTCACTCCTGATTTCTACAAAACAAGTTGCCCCCAGGCCCTCCCTGCA
ATTCGAAAGATTGTTAGGCAAGAAATAAAAAAGGAGACTCGAATGGGCGCTTCCCTCCTCCGATTGCACTTCCACGACTGCTTTGTCAAT
GGTTGTGACGGCTCCATACTACTGGACGAC
ACTGCCAATTTTACCGGAGAGAAGACGGCAGCTCCTAACGTAAACTCCGTGAGAGGGTTTGAAGTTATCGACAAAATCAAGTCGGAAGTTAACAGAAAATGCAAGGCTAATGTCGTCTCC
TGCGCTGACATCTTAGCCGTTGCTGCTCGTGACTCTGTCTCGATC
ATGGGAGGTCAAAGTTACTTCTACCAAGTTCCCTTAGGAAGAAGAGACGCCAGAACAGCCAGCCGCGCAGCCGCG
AACAACAGCCTCCCGCCGCCGACGTTCAACTTCTCGCAGCTAATCTCCAACTTCCAATCCCACGGCCTCAACCTCACCGATCTCGTGGCGCTTTCGGGAGGACACACAATCGGCGTGTCT
CGCTGCGTCAATTTCCGAAACCGGATCTACAACGAGACGTCCAACAGCATTCAGCCCCAATTCGCTTCCTCTTTGCAGCGTAACTGCCCGGCCGCCGCCGGAAGCGGGGACAACAACACC
CAGGGTCTCGACCAGACTCCAGAGGGATTCGACGTCCAGTACTTCAGGTCGTTGATTCAGTCGAGGGGGCTCCTGCATTCCGATCAGGAGCTGTTCGGGAAAGGTAATAGTGCGAGCGAC
GTGCTGGTGAGGATGTACGGCAGTAATCCGGGGAGGTTCGCGGCGGATTTTGCAGCGTCGATGGTTAAGATGGGGAATATGAAGCCACTTACCGGGAATAATGGGGAGATCAGAAAGAAT
TGTCGCATCGTTAATTAA

Retrieve as FASTA