Entry information : LuPrx64(Lus10009936|PACid:23150109)
Entry ID 12173
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx64(Lus10009936|PACid:23150109)
Name LuPrx64(Lus10009936|PACid:23150109)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx64
start..stop
S start..stop
LuPrx168 634 0 1..321 1..321
LuPrx49 436 2e-155 24..321 8..307
PpePrx54 435 6e-155 1..321 1..322
CsaPrx10 434 2e-154 7..321 12..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 208413..208622 210 N° 2 208729..208923 195 N° 3 209463..210023 561  
join(208413..208622,208729..208923,209463..210023)


exon

Literature and cross-references LuPrx64(Lus10009936|PACid:23150109)
DNA ref. Phytozome 12:   scaffold200 (208413..210023)
Protein sequence: LuPrx64(Lus10009936|PACid:23150109)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (298)
PWM (Da):   %s   34435.41 (31983.1)  
PI (pH):   %s   8.21 (8.00) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASKAFLTLAVSAFFLIQAISGQLTSNFYETICPEALPTIKRVVNKAIRDEPRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTAAPNLNSVRGFDVVDRIKSAVDKACKGSVVSCADILAVAARDSVSLLGGPQFWYQVLVGRRDAKTASISAANNNLPLPFFSFSQLLSSFQAQGLDLADLVALSGGHTIGLARCTTFRAHIYNDTNIHPKLAATLQKSCPPTGGDNNLKPLDSTPSRFNTDYYSELVRNRGLLHSDQELFGTGNSASDKLVMTYSSNPTKFAADFATSMVKMGNLQVVTGSAGEVRNNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCCAAAGCTTTCCTCACGCTTGCAGTATCAGCTTTCTTCCTCATCCAAGCTATTTCTGGACAACTAACGTCGAACTTTTACGAAACTATTTGCCCCGAAGCTTTGCCCACG
ATAAAAAGGGTAGTGAACAAGGCTATCAGAGATGAACCTCGCATGGGTGCATCACTGCTTCGTTTGCACTTCCATGACTGCTTCGTCAAT
GTACGTATTCACTCTCCTTATTAATTCGTC
TTCTGTTTTGTTTTTACACTGACGATTATTATGGCGAGTTATGATTAATTATGTGGTGAGAGATGAATTTATGCAGGGGTGCGACGGGTCAATTCTTTTGGACGACACATCAAGCTTTAC
TGGGGAGAAAACTGCTGCTCCGAATTTGAACTCGGTTAGAGGGTTTGATGTCGTTGACAGAATCAAGTCTGCAGTTGACAAAGCATGCAAAGGCAGTGTCGTCTCTTGCGCTGACATCTT
AGCTGTCGCTGCTCGTGATTCTGTCTCTTTG
GTAAGCATCCCAACACAACCACCCCCTCCATCTTATTAATATAAACTTGGGTCTGATATGTGGGAAGTTGGATAAAATAATTTTGTTAG
CCGTTGCGAGGTCATATCATAAAAAAAATAAAAAGATATATAGAAAGGTGAACTTATATAAATGGAATCGAAAGCCTTTAATACGCAAGATTTTTATGGGAAATGACTGTTAGTTTGATG
GACACTGTCTACAACAAATCATGATGAGATTATTATTAAATACATTAAGTCTCCTGTGTGACAGAAATGATAATAGTTTATGTCAGTAAGAAAAAAAAAAATTTAACTTCGATTTTATGA
TCAAAATATGCCTATATATTCGAATGTTTTTAACGAAGTGGCTCCGTCACGGATGACAGTAGTTACCTTGATCATTCTCCAAAATCACTATCGAGATCTAATTTCTTGTTGTTCAAGCAA
ACTATATTCAAAATTAATCCAACTTTCACCGCAAAACCCGAGCCACATTCATTTGTTTTAATGATTTTGAATTTTTATCATGTTATATAGTTGGGTGGCCCACAATTCTGGTACCAAGTC
CTAGTAGGAAGAAGAGACGCCAAGACAGCCAGCATCTCCGCAGCAAACAACAACCTCCCGCTCCCATTCTTCAGCTTCTCGCAACTCCTCTCAAGCTTCCAAGCCCAAGGCCTCGACCTC
GCCGACCTAGTCGCGCTCTCCGGCGGCCATACCATCGGGCTAGCTCGGTGCACCACTTTTCGCGCCCACATCTACAACGACACCAACATCCACCCCAAGTTGGCCGCCACCTTACAGAAG
TCCTGCCCTCCTACCGGCGGCGACAACAACCTCAAGCCTCTTGATTCGACTCCGTCCCGGTTCAATACCGACTACTACAGTGAGCTTGTCCGGAACAGAGGGCTTCTACACTCCGACCAG
GAACTGTTTGGAACTGGGAACAGTGCCAGCGACAAGCTTGTGATGACCTACAGTAGTAATCCGACGAAGTTCGCGGCGGATTTTGCGACGTCGATGGTCAAGATGGGGAATCTTCAGGTT
GTTACTGGGAGTGCTGGAGAGGTCAGGAACAACTGTCGCGTCGTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCCAAAGCTTTCCTCACGCTTGCAGTATCAGCTTTCTTCCTCATCCAAGCTATTTCTGGACAACTAACGTCGAACTTTTACGAAACTATTTGCCCCGAAGCTTTGCCCACG
ATAAAAAGGGTAGTGAACAAGGCTATCAGAGATGAACCTCGCATGGGTGCATCACTGCTTCGTTTGCACTTCCATGACTGCTTCGTCAAT
GGGTGCGACGGGTCAATTCTTTTGGACGAC
ACATCAAGCTTTACTGGGGAGAAAACTGCTGCTCCGAATTTGAACTCGGTTAGAGGGTTTGATGTCGTTGACAGAATCAAGTCTGCAGTTGACAAAGCATGCAAAGGCAGTGTCGTCTCT
TGCGCTGACATCTTAGCTGTCGCTGCTCGTGATTCTGTCTCTTTG
TTGGGTGGCCCACAATTCTGGTACCAAGTCCTAGTAGGAAGAAGAGACGCCAAGACAGCCAGCATCTCCGCAGCA
AACAACAACCTCCCGCTCCCATTCTTCAGCTTCTCGCAACTCCTCTCAAGCTTCCAAGCCCAAGGCCTCGACCTCGCCGACCTAGTCGCGCTCTCCGGCGGCCATACCATCGGGCTAGCT
CGGTGCACCACTTTTCGCGCCCACATCTACAACGACACCAACATCCACCCCAAGTTGGCCGCCACCTTACAGAAGTCCTGCCCTCCTACCGGCGGCGACAACAACCTCAAGCCTCTTGAT
TCGACTCCGTCCCGGTTCAATACCGACTACTACAGTGAGCTTGTCCGGAACAGAGGGCTTCTACACTCCGACCAGGAACTGTTTGGAACTGGGAACAGTGCCAGCGACAAGCTTGTGATG
ACCTACAGTAGTAATCCGACGAAGTTCGCGGCGGATTTTGCGACGTCGATGGTCAAGATGGGGAATCTTCAGGTTGTTACTGGGAGTGCTGGAGAGGTCAGGAACAACTGTCGCGTCGTT
AATTGA

Retrieve as FASTA