Entry information : LuPrx65(Lus10009937|PACid:23150143)
Entry ID 12174
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx65(Lus10009937|PACid:23150143)
Name LuPrx65(Lus10009937|PACid:23150143)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx65
start..stop
S start..stop
RcPrx52 412 4e-146 1..315 6..317
MePrx20 410 3e-145 3..315 18..329
MguPrx71 403 2e-142 22..315 9..309
PpePrx51 402 5e-142 7..315 10..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 213423..213597 175 N° 2 213117..213331 215 N° 3 211909..212466 558  
complement(join(211909..212466,213117..213331,213423..213597))


exon

Literature and cross-references LuPrx65(Lus10009937|PACid:23150143)
DNA ref. Phytozome 12:   scaffold200 (213597..211909)
Protein sequence: LuPrx65(Lus10009937|PACid:23150143)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (295)
PWM (Da):   %s   33411.45 (31230.4)  
PI (pH):   %s   6.5 (6.50) Peptide Signal:   %s   cut: 21 range:21-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYGLLYCAMLVFVAGGSYGQELASNYYDISCPKALSVIRSSVLGAVHKDRRMGASLLLSWFNEMQGCDGSVLLDDTGSFTGEKTAGPNMNSLRGFEVIDNIKSQVESVCPGVVSCADILTVAARDSVVALGGPSWNVQLGRRDSTTASYTAANTNLPSPSLDLPDLISSFTNKGFTVKQMVALSGSHTIGHARCLVFRNRIHGPGSDIESAFAESLKSTCPPLTGNNDTLSPLDATSPSFFDNAYFTNLVSKQGLLHSDQQLFSGGSTDAHVTDYAKRPRAFQADFAAAMVKMGGLGTLTGTEGEVRANCRRIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATATGGACTTCTTTACTGCGCGATGCTTGTGTTTGTTGCCGGAGGATCGTACGGGCAAGAACTGGCGTCGAATTACTACGACATAAGTTGCCCAAAGGCTCTATCAGTGATTCGG
AGTTCGGTGTTGGGTGCCGTCCATAAGGACCGTCGGATGGGAGCTTCTCTGCTAC
GTTTGCACTTCCATGACTGCTTTGTCAATGCAAGTTTCCTTCCAGTTTGCATGTGTTTTTTTGCT
CTGAATGTTTAATTTTATTTACTCAGTTTCATGGTTTAATGAAATGCAGGGATGTGATGGGTCGGTTTTGTTGGACGACACGGGGAGCTTCACCGGAGAAAAGACGGCGGGGCCGAACAT
GAACTCTTTGAGAGGGTTCGAAGTGATAGACAACATCAAGTCACAGGTGGAGTCGGTTTGTCCTGGAGTTGTTTCCTGCGCTGATATCCTCACTGTCGCTGCTAGAGATTCTGTTGTGGC
T
GTAAGTTCACTTTCAGAATAACTAGAAATCCGCATTTTACTGCGGAAAACAATAGAGTTTGAAAAGTTCGAAAACGAGGCCAATCAAATGATACAAAAAGTCTAAAAATATATGCAAAC
ATATATAATTGTGGGATAGATGAGCTGGACAGACCACCGTTTGGATTCAATAAATAATCGATTAATAAAGTTGAGGTTTGTCGGACGTCTGAAATAGAAATGCTTTTTTTAATGTATGTT
CTAAATTGGAAGGAAAATGAGTGTATAAAACTATAAAAAATGGTTCGTGGAATATACGTGAACACACAAGGTTATTTCTAGGGTCCCACAGCGGCCACAAAATTAATCGAAGGTCTCGTT
GCTCCACTAGTAACCACTAGCAATAAAATTTAAATGAAGGTATTTGAACGGTTTGAATTGACTTCAACGATAGTTTTTATGAGATCGGTTGGAGGAGTCTACCATGTTTATATTCTTCGC
TTTATGCCATAGACTAGAGTAACTATCGATCCGTTGGCAGGTTTATTTTTAATTATTTAAACTGGTCCGTTGACTGATTTACTTTTTAATTTTTAAGAAAACGATGTATCTAGAACAAAG
GTACTAAAAGTTTATTTGATGTAGCATTTATACCCATAAATTACCCTGCAGTTGGGAGGCCCATCGTGGAATGTCCAACTGGGAAGACGAGATTCAACGACGGCAAGCTACACCGCCGCA
AACACAAACCTTCCATCTCCATCCTTGGACCTCCCTGACCTCATCTCTTCCTTTACCAACAAAGGATTCACCGTCAAACAAATGGTCGCCCTCTCCGGGTCCCACACAATCGGCCACGCC
AGGTGCCTCGTTTTCCGCAACCGGATCCATGGACCCGGTTCGGATATCGAATCTGCATTTGCGGAGTCGCTCAAGTCAACCTGCCCACCTCTCACGGGCAACAACGACACATTGTCACCC
TTAGACGCCACATCTCCTTCCTTCTTCGACAACGCCTACTTCACTAACCTGGTTTCCAAACAGGGTCTCTTGCACTCTGATCAGCAGTTGTTCAGCGGTGGGTCCACTGACGCCCACGTC
ACCGATTACGCAAAACGTCCTCGTGCTTTCCAAGCCGATTTCGCTGCTGCCATGGTGAAGATGGGTGGACTCGGGACGCTGACCGGAACGGAAGGTGAGGTTCGAGCCAACTGCCGCAGA
ATAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATATGGACTTCTTTACTGCGCGATGCTTGTGTTTGTTGCCGGAGGATCGTACGGGCAAGAACTGGCGTCGAATTACTACGACATAAGTTGCCCAAAGGCTCTATCAGTGATTCGG
AGTTCGGTGTTGGGTGCCGTCCATAAGGACCGTCGGATGGGAGCTTCTCTGCTAC
TTTCATGGTTTAATGAAATGCAGGGATGTGATGGGTCGGTTTTGTTGGACGACACGGGGAGCTTC
ACCGGAGAAAAGACGGCGGGGCCGAACATGAACTCTTTGAGAGGGTTCGAAGTGATAGACAACATCAAGTCACAGGTGGAGTCGGTTTGTCCTGGAGTTGTTTCCTGCGCTGATATCCTC
ACTGTCGCTGCTAGAGATTCTGTTGTGGCT
TTGGGAGGCCCATCGTGGAATGTCCAACTGGGAAGACGAGATTCAACGACGGCAAGCTACACCGCCGCAAACACAAACCTTCCATCTCCA
TCCTTGGACCTCCCTGACCTCATCTCTTCCTTTACCAACAAAGGATTCACCGTCAAACAAATGGTCGCCCTCTCCGGGTCCCACACAATCGGCCACGCCAGGTGCCTCGTTTTCCGCAAC
CGGATCCATGGACCCGGTTCGGATATCGAATCTGCATTTGCGGAGTCGCTCAAGTCAACCTGCCCACCTCTCACGGGCAACAACGACACATTGTCACCCTTAGACGCCACATCTCCTTCC
TTCTTCGACAACGCCTACTTCACTAACCTGGTTTCCAAACAGGGTCTCTTGCACTCTGATCAGCAGTTGTTCAGCGGTGGGTCCACTGACGCCCACGTCACCGATTACGCAAAACGTCCT
CGTGCTTTCCAAGCCGATTTCGCTGCTGCCATGGTGAAGATGGGTGGACTCGGGACGCTGACCGGAACGGAAGGTGAGGTTCGAGCCAACTGCCGCAGAATAAACTGA

Retrieve as FASTA