Entry information : LuPrx66(Lus10009990|PACid:23176667)
Entry ID 12175
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx66(Lus10009990|PACid:23176667)
Name LuPrx66(Lus10009990|PACid:23176667)
Class Class III peroxidase    [Orthogroup: Prx179]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx66
start..stop
S start..stop
LuPrx197 600 0 18..336 18..338
EcamPrx151 334 1e-114 18..335 13..323
EgrPrx154 333 2e-114 18..335 5..315
EguPrx153 332 3e-114 18..335 5..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 146747..146965 219 N° 2 145836..146627 792  
complement(join(145836..146627,146747..146965))


exon

Literature and cross-references LuPrx66(Lus10009990|PACid:23176667)
DNA ref. Phytozome 12:   scaffold1630 (146965..145836)
Protein sequence: LuPrx66(Lus10009990|PACid:23176667)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (313)
PWM (Da):   %s   36086.44 (33587.1) Transmb domain:   %s   i7-24o
PI (pH):   %s   9 (9.00) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSNSSSTLLLFLLAIAVTHVAAAGRALEVGFYDSTCPSAERIVSRVVRKALTENPGLAPGIVRLHFHDFLVQGPDASILLDPVEGEPEPVEKKAPAHVPGLRGFEVIDAAKSALEARCPGTVSCADILAFAARDSASHASSARNFTYKVPAGRRDGNTSLASLVSQNLPPLSSDVDAIRQSFANKGLTLNETVALFGAHSFGTATCQFFSNRLYFFETNGTQGQDPSMNPGYARFLKSKCPKRGNGLGRGVNLDKVSPNILDVQYYQNLVNRMGLLDSDQGLMSNATTADLVKEYARNAGKWRRDFAAAMVKMGTIGVLTGNEGQIRKNCRLINK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCAATAGCAGCAGTACTCTGTTACTGTTTCTTCTGGCGATTGCAGTTACTCATGTGGCCGCGGCAGGTCGTGCTCTGGAAGTAGGGTTCTATGACTCCACGTGTCCCTCGGCC
GAAAGGATCGTGAGCCGAGTGGTGAGAAAGGCACTTACAGAAAACCCCGGGTTGGCTCCTGGGATCGTTCGCTTGCATTTCCACGATTTTCTTGTTCAG
GTAATTTGTGTACCTAACAAT
GTCATAAACTATAAACTATAAACTATTGTGTTTCAATAAGTTTAGAAAGTGTAGAAAATCATCTTAAAAAATAATGGTTATGATTCTCTATGGTACAGGGTCCCGACGCTTCGATACTGC
TCGATCCGGTCGAAGGCGAGCCGGAGCCCGTGGAGAAAAAGGCCCCTGCCCACGTCCCGGGCTTGCGAGGCTTCGAGGTGATCGACGCCGCGAAATCCGCCCTAGAAGCTCGATGCCCTG
GGACTGTCTCGTGCGCTGACATCCTCGCGTTCGCTGCACGCGACAGTGCCTCCCACGCCTCATCTGCAAGAAACTTCACCTACAAGGTTCCTGCAGGGAGGCGCGATGGAAACACGTCCC
TCGCATCGTTGGTCTCGCAAAATCTCCCTCCACTTTCTAGCGACGTGGATGCCATCCGGCAAAGCTTCGCTAACAAAGGCTTGACGTTGAATGAAACAGTGGCGCTATTCGGGGCCCACT
CGTTCGGAACTGCCACGTGCCAGTTCTTCTCTAACAGGCTATACTTCTTCGAGACGAATGGGACCCAGGGGCAGGACCCGTCAATGAATCCGGGCTATGCCCGGTTTCTAAAGTCCAAGT
GCCCTAAACGGGGAAATGGGCTGGGCCGTGGGGTGAATCTAGATAAGGTGAGCCCAAATATCCTTGACGTTCAGTATTACCAAAACTTGGTGAACAGGATGGGGCTGTTGGACTCTGATC
AAGGGCTGATGAGCAATGCTACCACGGCGGATCTCGTGAAGGAGTACGCCAGAAATGCGGGGAAGTGGCGGAGGGATTTCGCGGCGGCGATGGTGAAAATGGGAACCATCGGTGTGTTGA
CTGGGAATGAAGGCCAGATCAGGAAGAACTGTCGCCTTATTAATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCAATAGCAGCAGTACTCTGTTACTGTTTCTTCTGGCGATTGCAGTTACTCATGTGGCCGCGGCAGGTCGTGCTCTGGAAGTAGGGTTCTATGACTCCACGTGTCCCTCGGCC
GAAAGGATCGTGAGCCGAGTGGTGAGAAAGGCACTTACAGAAAACCCCGGGTTGGCTCCTGGGATCGTTCGCTTGCATTTCCACGATTTTCTTGTTCAG
GGTCCCGACGCTTCGATACTG
CTCGATCCGGTCGAAGGCGAGCCGGAGCCCGTGGAGAAAAAGGCCCCTGCCCACGTCCCGGGCTTGCGAGGCTTCGAGGTGATCGACGCCGCGAAATCCGCCCTAGAAGCTCGATGCCCT
GGGACTGTCTCGTGCGCTGACATCCTCGCGTTCGCTGCACGCGACAGTGCCTCCCACGCCTCATCTGCAAGAAACTTCACCTACAAGGTTCCTGCAGGGAGGCGCGATGGAAACACGTCC
CTCGCATCGTTGGTCTCGCAAAATCTCCCTCCACTTTCTAGCGACGTGGATGCCATCCGGCAAAGCTTCGCTAACAAAGGCTTGACGTTGAATGAAACAGTGGCGCTATTCGGGGCCCAC
TCGTTCGGAACTGCCACGTGCCAGTTCTTCTCTAACAGGCTATACTTCTTCGAGACGAATGGGACCCAGGGGCAGGACCCGTCAATGAATCCGGGCTATGCCCGGTTTCTAAAGTCCAAG
TGCCCTAAACGGGGAAATGGGCTGGGCCGTGGGGTGAATCTAGATAAGGTGAGCCCAAATATCCTTGACGTTCAGTATTACCAAAACTTGGTGAACAGGATGGGGCTGTTGGACTCTGAT
CAAGGGCTGATGAGCAATGCTACCACGGCGGATCTCGTGAAGGAGTACGCCAGAAATGCGGGGAAGTGGCGGAGGGATTTCGCGGCGGCGATGGTGAAAATGGGAACCATCGGTGTGTTG
ACTGGGAATGAAGGCCAGATCAGGAAGAACTGTCGCCTTATTAATAAATAA

Retrieve as FASTA