Entry information : LuPrx67(Lus10010634|PACid:23143632)
Entry ID 12176
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx67(Lus10010634|PACid:23143632)
Name LuPrx67(Lus10010634|PACid:23143632)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx67
start..stop
S start..stop
MePrx77 482 9e-173 6..344 5..346
GmPrx296 468 2e-167 18..344 1..333
TsPrx09 469 3e-167 17..344 10..352
BrPrx09-1Aa_other 468 5e-167 11..344 4..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 202984..203262 279 N° 2 203334..203525 192 N° 3 203614..203779 166 N° 4 203876..204273 398
join(202984..203262,203334..203525,203614..203779,203876..204273)


exon

Literature and cross-references LuPrx67(Lus10010634|PACid:23143632)
DNA ref. Phytozome 12:   scaffold296 (202984..204273)
Protein sequence: LuPrx67(Lus10010634|PACid:23143632)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (314)
PWM (Da):   %s   37360.07 (34143.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.33 (9.31) Peptide Signal:   %s   cut: 31 range:31-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPFCKIVFSFSALAVVVLVFSLSFAGSLAHPPDHTPHTGTRRSSSGLNPEYYTFSCPQANHIVVSVLGNVIARDPRMAASLLRLHFHDCFVQGCDASVLLDSSDEVASEKNAGPNRNSLRGFEVIDQIKAELERACPQTVSCADILAMAARGSTLLSGGPSWELPLGRKDSRTASISLSNQNIPPPNSTIQTLVNLFKRQGLNKIDLVALSGGHTIGVARCTTFKQRLYSQKGPDLSLERTYSMGLKSVCPRSGGDNNISPLDFGSPARFDNTYFNLILSGKGLLTSDQVLFTGGDTFQLVKRYAEDQQLFFAQFAKSMVRMGRVGVLTGFKGEVRKNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCATTCTGCAAAATTGTTTTCAGTTTCTCAGCACTAGCAGTTGTAGTACTTGTGTTTTCCTTGTCATTTGCTGGATCCCTAGCTCACCCTCCCGATCACACCCCTCACACAGGC
ACCCGCCGATCCTCCTCAGGTCTTAATCCCGAGTACTATACGTTTTCATGCCCTCAGGCTAACCACATTGTGGTATCGGTCCTCGGAAACGTCATCGCTAGAGATCCTAGGATGGCTGCT
TCCTTGCTTAGGCTCCATTTCCATGATTGCTTTGTGCAG
GTAATTTTTTATATACAGTACATATACCATGAATGAATGATCTCTAATAAGATGCATGTTTTTGATGACAGGGGTGTGATG
CGTCAGTTCTGCTGGACAGTAGCGACGAAGTTGCTAGTGAGAAGAATGCAGGTCCAAACAGGAATTCTTTGAGAGGGTTTGAAGTGATCGACCAGATCAAAGCAGAGTTGGAAAGAGCTT
GCCCTCAAACGGTCTCTTGTGCGGACATTCTCGCCATGGCAGCACGTGGATCTACACTACTC
GTACGTTAATCATTACAAAATCATAACACGATACGATAGCAAGTTTATAATCTCAACT
AATTTAACGTTTGTGTACAAATGGAAACAGAGTGGAGGACCGAGTTGGGAGCTACCTTTGGGAAGAAAGGACTCAAGAACAGCAAGCATAAGCTTGTCCAACCAGAACATTCCGCCTCCA
AACTCCACCATCCAGACCCTCGTTAACCTTTTCAAACGCCAAGGCCTTAACAAGATCGACCTCGTCGCACTCTCCG
GTCTGAAACTTAAATCCTAATAAAGCTTACTATTGTTCATGATT
CTTCAATAAGCCAATTCTGAATTTTTAGTGATGATTAATTGTACATGTGTAGGAGGGCACACGATAGGCGTGGCGAGATGCACGACGTTCAAGCAGAGACTGTACAGCCAAAAGGGTCCG
GACCTGAGTTTGGAGAGGACTTACTCCATGGGGTTGAAGTCGGTCTGTCCGAGATCGGGCGGTGACAACAACATTAGCCCTCTCGATTTCGGTTCCCCTGCCAGATTCGACAACACCTAC
TTCAACCTCATCCTGTCGGGCAAAGGCCTCCTCACTTCGGACCAAGTTCTGTTCACTGGTGGTGATACGTTTCAGTTGGTGAAGAGATATGCTGAGGACCAACAGCTTTTCTTTGCTCAG
TTCGCCAAGTCCATGGTCAGGATGGGGAGGGTTGGTGTTCTCACTGGCTTCAAGGGTGAGGTTCGTAAGAATTGCCGCCGTGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCATTCTGCAAAATTGTTTTCAGTTTCTCAGCACTAGCAGTTGTAGTACTTGTGTTTTCCTTGTCATTTGCTGGATCCCTAGCTCACCCTCCCGATCACACCCCTCACACAGGC
ACCCGCCGATCCTCCTCAGGTCTTAATCCCGAGTACTATACGTTTTCATGCCCTCAGGCTAACCACATTGTGGTATCGGTCCTCGGAAACGTCATCGCTAGAGATCCTAGGATGGCTGCT
TCCTTGCTTAGGCTCCATTTCCATGATTGCTTTGTGCAG
GGGTGTGATGCGTCAGTTCTGCTGGACAGTAGCGACGAAGTTGCTAGTGAGAAGAATGCAGGTCCAAACAGGAATTCTTTG
AGAGGGTTTGAAGTGATCGACCAGATCAAAGCAGAGTTGGAAAGAGCTTGCCCTCAAACGGTCTCTTGTGCGGACATTCTCGCCATGGCAGCACGTGGATCTACACTACTC
AGTGGAGGA
CCGAGTTGGGAGCTACCTTTGGGAAGAAAGGACTCAAGAACAGCAAGCATAAGCTTGTCCAACCAGAACATTCCGCCTCCAAACTCCACCATCCAGACCCTCGTTAACCTTTTCAAACGC
CAAGGCCTTAACAAGATCGACCTCGTCGCACTCTCCG
GAGGGCACACGATAGGCGTGGCGAGATGCACGACGTTCAAGCAGAGACTGTACAGCCAAAAGGGTCCGGACCTGAGTTTGGAG
AGGACTTACTCCATGGGGTTGAAGTCGGTCTGTCCGAGATCGGGCGGTGACAACAACATTAGCCCTCTCGATTTCGGTTCCCCTGCCAGATTCGACAACACCTACTTCAACCTCATCCTG
TCGGGCAAAGGCCTCCTCACTTCGGACCAAGTTCTGTTCACTGGTGGTGATACGTTTCAGTTGGTGAAGAGATATGCTGAGGACCAACAGCTTTTCTTTGCTCAGTTCGCCAAGTCCATG
GTCAGGATGGGGAGGGTTGGTGTTCTCACTGGCTTCAAGGGTGAGGTTCGTAAGAATTGCCGCCGTGTCAACTAA

Retrieve as FASTA