Entry information : LuPrx74(Lus10013065|PACid:23149832)
Entry ID 12181
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx74(Lus10013065|PACid:23149832)
Name LuPrx74(Lus10013065|PACid:23149832)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx74
start..stop
S start..stop
LuPrx162 650 0 1..331 1..331
MePrx12 481 2.22e-172 4..329 9..339
MePrx128 476 1.4e-170 18..329 25..341
CclPrx93 472 4.26e-169 11..329 16..337
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12181' 'join(451459..451674,451782..451973,452064..452229,452328..452746)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 451459..451674 214 N° 2 451782..451973 190 N° 3 452064..452229 164 N° 4 452328..452746 417
join(451459..451674,451782..451973,452064..452229,452328..452746)


exon

Literature and cross-references LuPrx74(Lus10013065|PACid:23149832)
DNA ref. Phytozome 12:   scaffold751 (451459..452746)
Protein sequence: LuPrx74(Lus10013065|PACid:23149832)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (306)
PWM (Da):   %s   36324.89 (33510.4) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.5 (4.45) Peptide Signal:   %s   cut: 25 range:25-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSNSFVFVMFIIFVAFPSRLIAGELTLDYYSETCPTVFGVVRKEMECVVLSDPRNAAKVIRLHFHDCFVQGCDGSILLDDTLMLKGEKSATPNAKSLKGFEIIDSIKNKVESDCPGVV
SCADILALAARDATVLVGGPDWEMYLGRKDSRTASYELADSNLPLPTEGLLSIISKFIYQGLSVTDMVALSGSHTIGMARCESYRDRIHGDYEVTSDESPASESHLKDLKATCPAAGGED
DTVSPMDYESPNLFDNSYFRILLRGEGLLNSDQELYSSILGMQTKQLVIQYAHDSVGFFEQFAQSMVRMGNITNEVDAGEVRRTCRFVNI*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTCTCCAACTCCTTTGTGTTCGTCATGTTCATCATCTTCGTCGCATTTCCCAGTAGATTGATTGCTGGAGAGTTAACTCTGGACTACTATTCCGAAACTTGCCCCACGGTGTTT
GGGGTTGTCAGGAAAGAAATGGAATGTGTTGTGCTTTCTGATCCTCGTAATGCTGCTAAGGTTATCAGGCTCCACTTCCACGACTGTTTTGTCCAG
AGGTAATTGAACACATGACGATTC
AAAAGTAACCCAACGACTGGAATCATTAATAACAGCATAAAGATTCAATCTTTTATGTAATGTGGTGGTGTTAATTTGGTTGCAGGGATGTGACGGGTCTATTCTGCTAGACGATACACT
GATGCTGAAAGGCGAAAAATCAGCCACCCCGAACGCGAAATCACTCAAAGGGTTCGAGATTATCGACAGTATTAAGAACAAAGTCGAATCCGATTGTCCCGGTGTCGTTTCTTGTGCCGA
TATCCTTGCACTGGCTGCTAGGGATGCAACAGTTCTG
TGGTATACCATGAATCCATGATCACTTCTTTTTTAACTTATCATTTCCATATTATCCACATTTACAAATTTAATTCTGTGATT
AATTGGTAGGTTGGTGGACCTGATTGGGAGATGTATTTAGGAAGAAAAGATTCAAGAACCGCGAGCTACGAGCTTGCAGATTCGAATCTCCCGCTTCCAACCGAGGGTCTCTTGTCGATC
ATATCAAAGTTCATTTACCAGGGACTCTCTGTTACAGACATGGTTGCTCTCTCAG
AGGTAAAAAAAATTGTCACCACTCAATTTTGTATAATAAATCAGTTAAAACAGCTAGTTTCACCA
GTTCAATCTGTTTATAAAAAAACCGCCATGTGCAGGGTCCCACACGATAGGGATGGCTCGGTGCGAGAGCTACAGGGACAGGATCCACGGGGACTACGAGGTGACATCGGACGAATCTCC
GGCCTCGGAGTCCCACCTCAAAGATCTGAAGGCCACATGTCCGGCAGCTGGTGGCGAAGACGACACTGTCTCCCCGATGGACTACGAGAGTCCGAACCTATTCGACAATTCCTACTTCCG
TATTTTGTTGAGAGGAGAGGGACTCCTCAATTCCGACCAGGAGCTCTACTCCAGCATCCTCGGGATGCAGACAAAGCAGCTCGTGATCCAATACGCTCATGACTCAGTCGGGTTTTTCGA
GCAGTTCGCCCAGTCTATGGTCAGGATGGGGAACATTACTAATGAGGTTGATGCCGGGGAGGTCAGGAGGACCTGCCGATTTGTTAACATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTCTCCAACTCCTTTGTGTTCGTCATGTTCATCATCTTCGTCGCATTTCCCAGTAGATTGATTGCTGGAGAGTTAACTCTGGACTACTATTCCGAAACTTGCCCCACGGTGTTT
GGGGTTGTCAGGAAAGAAATGGAATGTGTTGTGCTTTCTGATCCTCGTAATGCTGCTAAGGTTATCAGGCTCCACTTCCACGACTGTTTTGTCCAG
GGATGTGACGGGTCTATTCTGCTA
GACGATACACTGATGCTGAAAGGCGAAAAATCAGCCACCCCGAACGCGAAATCACTCAAAGGGTTCGAGATTATCGACAGTATTAAGAACAAAGTCGAATCCGATTGTCCCGGTGTCGTT
TCTTGTGCCGATATCCTTGCACTGGCTGCTAGGGATGCAACAGTTCTG
GTTGGTGGACCTGATTGGGAGATGTATTTAGGAAGAAAAGATTCAAGAACCGCGAGCTACGAGCTTGCAGAT
TCGAATCTCCCGCTTCCAACCGAGGGTCTCTTGTCGATCATATCAAAGTTCATTTACCAGGGACTCTCTGTTACAGACATGGTTGCTCTCTCAG
GGTCCCACACGATAGGGATGGCTCGG
TGCGAGAGCTACAGGGACAGGATCCACGGGGACTACGAGGTGACATCGGACGAATCTCCGGCCTCGGAGTCCCACCTCAAAGATCTGAAGGCCACATGTCCGGCAGCTGGTGGCGAAGAC
GACACTGTCTCCCCGATGGACTACGAGAGTCCGAACCTATTCGACAATTCCTACTTCCGTATTTTGTTGAGAGGAGAGGGACTCCTCAATTCCGACCAGGAGCTCTACTCCAGCATCCTC
GGGATGCAGACAAAGCAGCTCGTGATCCAATACGCTCATGACTCAGTCGGGTTTTTCGAGCAGTTCGCCCAGTCTATGGTCAGGATGGGGAACATTACTAATGAGGTTGATGCCGGGGAG
GTCAGGAGGACCTGCCGATTTGTTAACATTTGA

Retrieve as FASTA