Entry information : LuPrx86(Lus10015580|PACid:23145888)
Entry ID 12188
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx86(Lus10015580|PACid:23145888)
Name LuPrx86(Lus10015580|PACid:23145888)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx86
start..stop
S start..stop
LuPrx182 444 4e-159 1..270 62..325
PtPrx90 360 7e-126 1..270 66..330
PnPrx90 358 3e-125 1..270 65..329
CclPrx110 358 4e-125 1..269 65..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166768..166794 27 N° 2 166498..166689 192 N° 3 166224..166388 165 N° 4 165724..166152 429
complement(join(165724..166152,166224..166388,166498..166689,166768..166794))


exon

Literature and cross-references LuPrx86(Lus10015580|PACid:23145888)
DNA ref. Phytozome 12:   scaffold233 (166794..165724)
Protein sequence: LuPrx86(Lus10015580|PACid:23145888)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   270
PWM (Da):   %s   28949.63  
PI (pH):   %s   9.54
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHFHDCFVRGCDVSVLIDSTTSNTAEKDNPANNPSLRGFQVIDTAKSRLKGICKGVVSCADILAFAARDRIELSGGVGYDIPLGRRDGRISSLSEASSNLPRPSANVAQLLKSSPTRDFLRPKWSLSPLFKFVVAGHTIGRSHCTSVSPRLYNFNGTGQDPTLDSNYATALKQQCPQGNSNANLVVPMNPSSPAVLDESYYVDILSNRGLFTSDQILLTNAATAAQVSQNAASRARWSAKFSADMVKMGQIGVSTGTAGEIRANRRVINS*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACTTCCACGACTGCTTCGTCCGAGTAAGTTAGTTATTGTCTCTCGATTTTTGTGATTTCGGCATGAGTATTAACAACAATCTTCACCATGTTTCGGCTCAGGGGTGCGATGTATCA
GTATTGATAGATTCGACCACATCCAACACGGCTGAGAAAGACAACCCGGCCAACAACCCCAGCCTTCGAGGTTTCCAAGTGATCGATACCGCCAAGTCTAGGCTCAAAGGCATCTGCAAA
GGGGTTGTTTCTTGTGCTGACATTCTGGCCTTCGCTGCAAGGGATCGCATCGAGTTG
GTACGTACAACTGATGTTTTTCTTACTTTTCAATTTTCACCTGTTTTTTTTACTTTTCAATTT
TCACCTGTCATACCAAGCCTATGTCTTCACAGTTTTATGCTTGCAGAGTGGAGGAGTTGGCTACGACATCCCTTTGGGAAGAAGAGACGGCAGAATTTCATCGTTGTCTGAAGCCTCATC
AAACTTACCTCGTCCATCAGCCAACGTAGCTCAACTCCTCAAATCTTCGCCAACAAGGGACTTTCTCAGGCCAAAATGGTCTCTCTCTCCG
GTATACATGAGACCGCACCCTCTAGTATG
GTACCGAAATAAGGTCGCCCTTTGTTTTTGCGAAAATTTAAGCTCTTCAAATTCGTGGTTGCAGGACATACCATAGGCCGTTCGCACTGCACATCCGTGTCGCCTAGGCTGTACAACTTC
AACGGAACGGGTCAGGATCCGACTCTGGACTCCAACTATGCCACAGCCTTGAAGCAGCAGTGTCCACAGGGGAACTCCAATGCTAACCTTGTGGTGCCGATGAATCCTAGCAGCCCCGCC
GTATTGGATGAGAGCTACTACGTGGACATCCTCTCCAACCGCGGCCTCTTCACCTCTGACCAGATCCTGCTCACAAACGCTGCAACCGCAGCCCAGGTTAGCCAGAATGCAGCAAGCCGG
GCTCGCTGGAGTGCCAAGTTTTCCGCTGACATGGTTAAGATGGGTCAGATCGGCGTTTCGACTGGCACCGCTGGTGAGATTCGAGCCAACCGCAGGGTAATCAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCACTTCCACGACTGCTTCGTCCGAGGGTGCGATGTATCAGTATTGATAGATTCGACCACATCCAACACGGCTGAGAAAGACAACCCGGCCAACAACCCCAGCCTTCGAGGTTTCCAA
GTGATCGATACCGCCAAGTCTAGGCTCAAAGGCATCTGCAAAGGGGTTGTTTCTTGTGCTGACATTCTGGCCTTCGCTGCAAGGGATCGCATCGAGTTG
AGTGGAGGAGTTGGCTACGAC
ATCCCTTTGGGAAGAAGAGACGGCAGAATTTCATCGTTGTCTGAAGCCTCATCAAACTTACCTCGTCCATCAGCCAACGTAGCTCAACTCCTCAAATCTTCGCCAACAAGGGACTTTCTC
AGGCCAAAATGGTCTCTCTCTCCG
CTCTTCAAATTCGTGGTTGCAGGACATACCATAGGCCGTTCGCACTGCACATCCGTGTCGCCTAGGCTGTACAACTTCAACGGAACGGGTCAGGAT
CCGACTCTGGACTCCAACTATGCCACAGCCTTGAAGCAGCAGTGTCCACAGGGGAACTCCAATGCTAACCTTGTGGTGCCGATGAATCCTAGCAGCCCCGCCGTATTGGATGAGAGCTAC
TACGTGGACATCCTCTCCAACCGCGGCCTCTTCACCTCTGACCAGATCCTGCTCACAAACGCTGCAACCGCAGCCCAGGTTAGCCAGAATGCAGCAAGCCGGGCTCGCTGGAGTGCCAAG
TTTTCCGCTGACATGGTTAAGATGGGTCAGATCGGCGTTTCGACTGGCACCGCTGGTGAGATTCGAGCCAACCGCAGGGTAATCAACAGCTAG

Retrieve as FASTA