Entry information : LuPrx99(Lus10018374|PACid:23162149)
Entry ID 12189
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx99(Lus10018374|PACid:23162149)
Name LuPrx99(Lus10018374|PACid:23162149)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx99
start..stop
S start..stop
LuPrx39 615 0 1..325 1..326
LuPrx33 477 3e-171 19..324 19..324
MePrx97 452 1.33e-161 1..324 1..328
MePrx110 446 4.59e-159 2..324 3..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12189' 'join(131137..131349,131462..131650,131732..132304)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 131137..131349 211 N° 2 131462..131650 187 N° 3 131732..132304 571  
join(131137..131349,131462..131650,131732..132304)


exon

Literature and cross-references LuPrx99(Lus10018374|PACid:23162149)
DNA ref. Phytozome 12:   scaffold251 (131137..132304)
Protein sequence: LuPrx99(Lus10018374|PACid:23162149)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (300)
PWM (Da):   %s   35581.1 (32877.7)  
PI (pH):   %s   9.26 (9.14) Peptide Signal:   %s   cut: 25 range:25-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSLSKYLILALFFGLFTISNAQLKVGYYSKSCPNAEAIVKKEMDQVMYMAPSLGGPLVRMHFHDCFVRGCDGSVLITSTKNNQAEKDAIPNLSLRGFGVIDRIKYALEKACPGIVSC
SDIMAIVARDVVVAMKGQYWEVETGRRDGRVSIMMDALTGSLPPPFSNISTLISAFKVVGLSAKDLVVLQGAHTIGTSHCSSFTNRIYNFTGKGDVDPALDSNYVSKLKRKCTPSDQTTL
VEMDPGSFKTFDNEYYKLVAKRRGLFQSDSALMDNPLTKAYVEKYVTVGSTFLKDFGESMVRMGRIGVLTGKQGEIRKVCYKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTTCTTCTTTATCGAAGTACTTGATCTTGGCTTTGTTTTTTGGCCTCTTCACGATCTCAAACGCCCAACTCAAAGTGGGTTACTACTCAAAGTCTTGCCCTAATGCTGAGGCC
ATAGTCAAGAAGGAGATGGATCAAGTCATGTACATGGCTCCTTCCCTCGGCGGGCCCTTGGTCCGCATGCATTTCCACGACTGCTTCGTCAGG
GGGTAACTATTATCTCGAAAACTTCGC
ATACTAATGATCATTATTGCGTGATTACCTTAATTAGGGTTTAGTATGTGTTAGTGTCACATATATATCACAATTTTTTGTTAACAGGGTTGTGACGGTTCTGTTCTAATCACCTCGACG
AAAAACAACCAAGCTGAAAAGGATGCGATCCCGAACCTCAGTTTGAGAGGGTTTGGAGTCATCGACCGCATAAAATACGCCCTAGAGAAGGCATGCCCTGGAATTGTGTCGTGCTCTGAT
ATCATGGCTATCGTAGCTAGAGATGTTGTAGTTGCG
CGGTAAATAACTTTTCACCCTTTCAATCTCCTTTTATGGGCTTCCGTTACAATGATATATAACAAGCTCTCGTATCACCACAGA
TGAAAGGTCAGTACTGGGAAGTTGAAACAGGCAGGAGAGACGGACGAGTTTCGATCATGATGGACGCTCTAACCGGATCCCTCCCACCGCCATTTTCGAACATCTCGACCCTTATCTCGG
CGTTCAAAGTCGTAGGACTCTCGGCCAAGGACTTGGTGGTCTTACAAGGCGCCCACACCATAGGAACCTCCCATTGCTCTTCCTTCACTAACAGAATCTACAACTTCACCGGCAAAGGTG
ATGTGGATCCGGCACTCGACTCCAACTATGTATCCAAGCTCAAGAGAAAATGTACGCCGTCCGATCAGACTACCTTGGTGGAGATGGACCCAGGGAGCTTCAAGACATTTGACAACGAGT
ACTACAAGCTGGTAGCTAAAAGGAGGGGTTTGTTCCAGTCCGACTCGGCACTGATGGATAACCCTTTAACCAAGGCTTACGTGGAGAAGTATGTGACAGTTGGATCGACTTTCTTGAAGG
ACTTTGGCGAGTCGATGGTCAGGATGGGGAGGATCGGTGTGCTTACTGGAAAGCAAGGTGAAATCAGGAAAGTCTGCTACAAGACTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACTTCTTCTTTATCGAAGTACTTGATCTTGGCTTTGTTTTTTGGCCTCTTCACGATCTCAAACGCCCAACTCAAAGTGGGTTACTACTCAAAGTCTTGCCCTAATGCTGAGGCC
ATAGTCAAGAAGGAGATGGATCAAGTCATGTACATGGCTCCTTCCCTCGGCGGGCCCTTGGTCCGCATGCATTTCCACGACTGCTTCGTCAGG
GGTTGTGACGGTTCTGTTCTAATCACC
TCGACGAAAAACAACCAAGCTGAAAAGGATGCGATCCCGAACCTCAGTTTGAGAGGGTTTGGAGTCATCGACCGCATAAAATACGCCCTAGAGAAGGCATGCCCTGGAATTGTGTCGTGC
TCTGATATCATGGCTATCGTAGCTAGAGATGTTGTAGTTGCG
ATGAAAGGTCAGTACTGGGAAGTTGAAACAGGCAGGAGAGACGGACGAGTTTCGATCATGATGGACGCTCTAACCGGA
TCCCTCCCACCGCCATTTTCGAACATCTCGACCCTTATCTCGGCGTTCAAAGTCGTAGGACTCTCGGCCAAGGACTTGGTGGTCTTACAAGGCGCCCACACCATAGGAACCTCCCATTGC
TCTTCCTTCACTAACAGAATCTACAACTTCACCGGCAAAGGTGATGTGGATCCGGCACTCGACTCCAACTATGTATCCAAGCTCAAGAGAAAATGTACGCCGTCCGATCAGACTACCTTG
GTGGAGATGGACCCAGGGAGCTTCAAGACATTTGACAACGAGTACTACAAGCTGGTAGCTAAAAGGAGGGGTTTGTTCCAGTCCGACTCGGCACTGATGGATAACCCTTTAACCAAGGCT
TACGTGGAGAAGTATGTGACAGTTGGATCGACTTTCTTGAAGGACTTTGGCGAGTCGATGGTCAGGATGGGGAGGATCGGTGTGCTTACTGGAAAGCAAGGTGAAATCAGGAAAGTCTGC
TACAAGACTAATTAA

Retrieve as FASTA