Entry information : PanHalPrx02
Entry ID 12211
Creation 2013-05-30 (Christophe Dunand)
Last sequence changes 2013-05-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Christophe Dunand)
Peroxidase information: PanHalPrx02
Name PanHalPrx02
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Lasiosphaeriaceae Podospora
Organism Podospora anserina    [TaxId: 5145 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PanHalPrx02
start..stop
S start..stop
TterHalPrx01 225 9e-74 1..217 1..230
AnHalPrx01 222 1e-72 8..234 5..238
CgHalPrx02 216 2e-70 24..234 19..230
CgHalPrx01 216 4e-70 9..229 8..229
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10171..10273 103 N° 2 9868..10108 241 N° 3 9545..9813 269 N° 4 9295..9482 188
complement(join(9295..9482,9545..9813,9868..10108,10171..10273))


exon

Literature and cross-references PanHalPrx02
Protein ref. UniProtKB:   B2ADX1
DNA ref. GenBank:   CU633455.1 (10273..9295)
Protein sequence: PanHalPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   266 (245)
PWM (Da):   %s   29459.86 (27402.8)  
PI (pH):   %s   5.85 (5.58) Peptide Signal:   %s   cut: 22 range:22-266
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLAAFLSLAVAAAAVNVSNSDPFEQWHGPKAGDVRGPCPFLNTFANHGFLPRTGKYITLDDLTNGLFNAVNFDANISAFLFDFAISTNPEPNSTWFSLDHLTRHNVLEHDASLSRVDAFHGHADIFNQEAFDETRSHWGDIVNVESGAAAIVARMKTCKSTNPQYSLSQLGEAFILGETAAFISILGDAEALTVEKTRVEYLQNERLPTELGWKRPEAQFTTDILVRNLQAVAVEYQKRLNSTVLRKRGVDYAERLMDGRARVL

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACTTGCAGCCTTTCTTTCTTTGGCGGTGGCCGCTGCGGCTGTCAATGTGTCCAACAGCGACCCCTTTGAGCAATGGCATGGGCCTAAGGCAGGCGATGGTGCGTAATTCTCACAG
CGGGAGATCTGTGATGCCTGATTGCATCAGCTAACCTTTTCATAGTCCGTGGGCCATGCCCATTCCTAAACACCTTTGCCAACCACGGCTTCCTCCCTCGTACCGGCAAATACATCACCC
TCGATGACCTCACCAACGGCCTCTTCAACGCTGTCAACTTCGATGCCAACATCTCCGCTTTCCTCTTTGACTTCGCCATCAGCACGAACCCGGAGCCGAACTCTACCTGGTTCTCGCTTG
ACCACTTGACCCGCCACAACGTGCTGGAGCATGATGCCAGTCTCTC
GTATGTCACACCCCCATAAACTCCAATGGATTGCTCTGATATATGTCTTCACAGTCGCGTCGACGCCTTCCACG
GCCACGCCGACATTTTCAACCAGGAAGCCTTTGACGAAACCCGCTCCCACTGGGGCGACATCGTCAACGTCGAGAGCGGTGCCGCTGCCATCGTCGCTCGCATGAAGACATGCAAATCAA
CCAATCCTCAATACTCCCTCTCCCAACTTGGCGAGGCTTTCATCCTCGGCGAGACAGCCGCGTTCATCTCCATCCTCGGAGACGCTGAGGCCCTCACTGTCGAGAAGACGCGTGTGGAAT
ACCTTTTCC
GTACGTTTAGCATCGTTCTATCACACTCATTGAAGTTCCGGTTTCTGACTTGGTAAATATAGAAAACGAGCGTCTCCCGACCGAACTTGGCTGGAAGAGACCCGAGGCTCA
GTTCACGACCGATATTCTGGTGCGGAACCTGCAGGCGGTGGCTGTCGAGTATCAGAAGAGGCTGAACTCGACTGTCTTGAGGAAGAGGGGGGTGGATTATGCTGAGCGGTTGATGGATGG
TAGGGCGAGGGTGCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACTTGCAGCCTTTCTTTCTTTGGCGGTGGCCGCTGCGGCTGTCAATGTGTCCAACAGCGACCCCTTTGAGCAATGGCATGGGCCTAAGGCAGGCGATGTCCGTGGGCCATGCCCA
TTCCTAAACACCTTTGCCAACCACGGCTTCCTCCCTCGTACCGGCAAATACATCACCCTCGATGACCTCACCAACGGCCTCTTCAACGCTGTCAACTTCGATGCCAACATCTCCGCTTTC
CTCTTTGACTTCGCCATCAGCACGAACCCGGAGCCGAACTCTACCTGGTTCTCGCTTGACCACTTGACCCGCCACAACGTGCTGGAGCATGATGCCAGTCTCTC
TCGCGTCGACGCCTTC
CACGGCCACGCCGACATTTTCAACCAGGAAGCCTTTGACGAAACCCGCTCCCACTGGGGCGACATCGTCAACGTCGAGAGCGGTGCCGCTGCCATCGTCGCTCGCATGAAGACATGCAAA
TCAACCAATCCTCAATACTCCCTCTCCCAACTTGGCGAGGCTTTCATCCTCGGCGAGACAGCCGCGTTCATCTCCATCCTCGGAGACGCTGAGGCCCTCACTGTCGAGAAGACGCGTGTG
GAATACCTTTTCC
AAAACGAGCGTCTCCCGACCGAACTTGGCTGGAAGAGACCCGAGGCTCAGTTCACGACCGATATTCTGGTGCGGAACCTGCAGGCGGTGGCTGTCGAGTATCAGAAG
AGGCTGAACTCGACTGTCTTGAGGAAGAGGGGGGTGGATTATGCTGAGCGGTTGATGGATGGTAGGGCGAGGGTGCTCTAG

Retrieve as FASTA