Entry information : CberGPx01
Entry ID 12220
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: CberGPx01
Name CberGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Cucurbitariaceae Cucurbitaria
Organism Cucurbitaria berberidis    [TaxId: 45142 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CberGPx01
start..stop
S start..stop
PtritGPx01 323 7.61e-114 1..165 104..268
PterGPx01 322 1.34e-113 1..165 101..265
AalteGPx01 319 7.33e-113 1..168 72..239
SturGPx01 314 5.89e-112 1..168 1..168
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12220' 'complement(join(6822360..6822557,6822664..6822929,6823067..6823109))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6823067..6823109 41 N° 2 6822664..6822929 264 N° 3 6822360..6822557 196  
complement(join(6822360..6822557,6822664..6822929,6823067..6823109))


exon

Literature and cross-references CberGPx01
DNA ref. JGI genome:   scaffold_2 (6823109..6822360)
Cluster/Prediction ref. JGI gene:   278105
Protein sequence: CberGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18843.65  
PI (pH):   %s   9.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYDFKPKDKRGSTYDLNKLNGKVVLIVNTASKCGFTPQFAGLEKLYKDLKAAHPNDFEIIGFPCNQFGGQDPGSNDEIQEFCQLNYGVSFPILGKVDVNGDKADPAFEWLKNEK
PGLMGLRRVKWNFEKFLVGRDGKVKGRWASTKKPEDLKADIEKELAAKA*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAACGAGCTTTTACGACTTCAAGCCCAAAGACAGTACGTCCCTTCTTTCTCACAGCAGCGTAGAGAAGCCATTCTTCGTCCCTGTAGAGTCATGTGCAATACCCCGTTCC
TGCATCCCTCCCCTCCCACATCGCAGCAGCAGTCAAGCTAACCACACACACCCTCCACAGAGAGCGCGGCAGCACCTACGACCTCAACAAGCTCAACGGCAAAGTCGTCCTCATCGTAAA
CACGGCGTCGAAATGCGGCTTCACCCCGCAATTCGCCGGTCTGGAGAAGCTCTACAAGGACCTGAAAGCCGCACATCCCAACGACTTTGAAATCATCGGGTTCCCCTGCAACCAGTTTGG
CGGCCAGGACCCGGGCTCCAACGATGAGATCCAGGAGTTCTGCCAGCTGAACTATGGCGTGTCGTTCCCCATCTTGGGCAAGGTCGAC
GTTAGTTACACCCCCTCCGTCTCGCCTCCCCC
TATATCATATCACTTTTCTCGCTACACCATGACGAGTATGAACGCTTTTTTCTAACCACCACCGCACCCAACAGGTGTCAACGGCGACAAAGCAGACCCGGCTTTCGAATGGCTCAAGAA
CGAGAAACCCGGCCTCATGGGCTTGAGGCGCGTCAAGTGGAACTTTGAAAAGTTCCTGGTGGGCCGTGATGGCAAGGTCAAGGGCCGCTGGGCGAGCACCAAGAAGCCCGAGGACTTGAA
GGCCGACATTGAGAAGGAGTTGGCTGCCAAGGCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAACGAGCTTTTACGACTTCAAGCCCAAAGACAAGCGCGGCAGCACCTACGACCTCAACAAGCTCAACGGCAAAGTCGTCCTCATCGTAAACACGGCGTCGAAATGCGGC
TTCACCCCGCAATTCGCCGGTCTGGAGAAGCTCTACAAGGACCTGAAAGCCGCACATCCCAACGACTTTGAAATCATCGGGTTCCCCTGCAACCAGTTTGGCGGCCAGGACCCGGGCTCC
AACGATGAGATCCAGGAGTTCTGCCAGCTGAACTATGGCGTGTCGTTCCCCATCTTGGGCAAGGTCGAC
GTCAACGGCGACAAAGCAGACCCGGCTTTCGAATGGCTCAAGAACGAGAAA
CCCGGCCTCATGGGCTTGAGGCGCGTCAAGTGGAACTTTGAAAAGTTCCTGGTGGGCCGTGATGGCAAGGTCAAGGGCCGCTGGGCGAGCACCAAGAAGCCCGAGGACTTGAAGGCCGAC
ATTGAGAAGGAGTTGGCTGCCAAGGCG

Retrieve as FASTA