Entry information : LfluCIIAC03
Entry ID 12222
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-10-16 (Nizar Fawal)
Peroxidase information: LfluCIIAC03
Name LfluCIIAC03
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluCIIAC03
start..stop
S start..stop
DexiCIIAC01 399 7.1e-141 1..307 1..310
PnoCIIAC03 378 1.04e-132 26..307 22..310
GsteCIIAA03 375 3.31e-131 1..309 1..332
LfluCIIAC01 366 8.31e-128 1..304 1..317
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12222' 'complement(join(36025..36584,36635..37010))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 36635..37010 374 N° 2 36025..36584 558  
complement(join(36025..36584,36635..37010))


exon

Literature and cross-references LfluCIIAC03
DNA ref. JGI genome:   scaffold_74 (37010..36025)
Cluster/Prediction ref. JGI gene:   195312
Protein sequence: LfluCIIAC03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (294)
PWM (Da):   %s   32999.4 (31152.5)  
PI (pH):   %s   8.05 (7.81) Peptide Signal:   %s   cut: 18 range:18-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHCKNLLFLASTASATSFPSLEDLSNSVKDVLSRRDGSCPAVWSKVSAELTTMFLTGGQCNDDARAAIRLNFHECGSWETKLGATGGCDGSIILANELTRAENRGLADIASKVQNLATKY
GSGLADMIVFAGSHATVTCPGGPVVKTWVGRKDSSVPAPEGLLPDVQASADALFTLFKNKGFNDVDLAALLGAHSVSKQFFVDTTKAGQPQDSTPGIWDVKYYSETTSPAVGDFVFPSDS
KLAAHAVVGKQFKGFVNNQGKWNGKYADAMARMNLFGVANTNGMLDCTSALPKSTNVKREMRAMPVYGRTA*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTGCAAGAACCTCCTTTTCCTCGCCTCGACCGCTTCAGCAACCTCCTTCCCAAGCCTTGAGGACCTCTCCAACAGCGTCAAAGATGTTTTGAGCCGCCGTGACGGCTCTTGTCCT
GCTGTTTGGAGCAAGGTCTCTGCAGAGCTTACCACAATGTTCCTAACGGGCGGCCAGTGCAATGACGACGCACGTGCCGCTATTCGCCTAAATTTCCACGAGTGCGGTTCTTGGGAGACT
AAACTCGGCGCCACCGGTGGCTGCGATGGAAGCATCATCTTGGCCAACGAACTCACCCGAGCCGAAAACAGGGGGCTCGCTGACATTGCAAGCAAGGTTCAGAACCTTGCGACCAAATAC
GGGTCTGGGCTTGCCG
GTCAGTGCTCAAGCTATATCCCATGGTGGACAAAACTGATATATTGATAGATATATGATCGTGTTCGCAGGCTCGCACGCTACGGTCACCTGCCCTGGTGGACC
AGTCGTCAAGACATGGGTTGGCCGCAAAGATTCATCAGTTCCAGCACCAGAAGGTCTTCTCCCCGACGTGCAAGCCTCTGCAGATGCACTCTTTACGCTGTTCAAGAACAAGGGATTCAA
CGATGTCGACCTTGCCGCTCTTCTTGGCGCCCACTCTGTGTCGAAGCAATTCTTCGTTGATACAACCAAGGCCGGCCAGCCCCAGGATAGCACACCGGGTATCTGGGATGTCAAGTACTA
CTCTGAGACTACTTCGCCTGCCGTAGGTGACTTTGTGTTCCCATCCGACTCCAAGCTGGCGGCCCATGCCGTTGTCGGCAAGCAGTTCAAGGGCTTTGTCAACAACCAGGGCAAGTGGAA
CGGAAAGTATGCGGATGCCATGGCCCGCATGAATCTCTTTGGCGTAGCAAACACAAACGGTATGCTCGATTGCACCAGTGCACTGCCAAAGTCGACCAACGTCAAGCGAGAGATGCGTGC
CATGCCTGTGTATGGCAGGACGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTGCAAGAACCTCCTTTTCCTCGCCTCGACCGCTTCAGCAACCTCCTTCCCAAGCCTTGAGGACCTCTCCAACAGCGTCAAAGATGTTTTGAGCCGCCGTGACGGCTCTTGTCCT
GCTGTTTGGAGCAAGGTCTCTGCAGAGCTTACCACAATGTTCCTAACGGGCGGCCAGTGCAATGACGACGCACGTGCCGCTATTCGCCTAAATTTCCACGAGTGCGGTTCTTGGGAGACT
AAACTCGGCGCCACCGGTGGCTGCGATGGAAGCATCATCTTGGCCAACGAACTCACCCGAGCCGAAAACAGGGGGCTCGCTGACATTGCAAGCAAGGTTCAGAACCTTGCGACCAAATAC
GGGTCTGGGCTTGCCG
ATATGATCGTGTTCGCAGGCTCGCACGCTACGGTCACCTGCCCTGGTGGACCAGTCGTCAAGACATGGGTTGGCCGCAAAGATTCATCAGTTCCAGCACCAGAA
GGTCTTCTCCCCGACGTGCAAGCCTCTGCAGATGCACTCTTTACGCTGTTCAAGAACAAGGGATTCAACGATGTCGACCTTGCCGCTCTTCTTGGCGCCCACTCTGTGTCGAAGCAATTC
TTCGTTGATACAACCAAGGCCGGCCAGCCCCAGGATAGCACACCGGGTATCTGGGATGTCAAGTACTACTCTGAGACTACTTCGCCTGCCGTAGGTGACTTTGTGTTCCCATCCGACTCC
AAGCTGGCGGCCCATGCCGTTGTCGGCAAGCAGTTCAAGGGCTTTGTCAACAACCAGGGCAAGTGGAACGGAAAGTATGCGGATGCCATGGCCCGCATGAATCTCTTTGGCGTAGCAAAC
ACAAACGGTATGCTCGATTGCACCAGTGCACTGCCAAAGTCGACCAACGTCAAGCGAGAGATGCGTGCCATGCCTGTGTATGGCAGGACGGCATGA

Retrieve as FASTA