Entry information : LfluCIIAC01
Entry ID 12226
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: LfluCIIAC01
Name LfluCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluCIIAC01
start..stop
S start..stop
PnoCIIAC03 423 2.9e-150 19..324 19..314
DexiCIIAC01 414 1.72e-146 19..325 19..315
LfluCIIAC03 371 1.12e-129 1..317 1..304
GsteCIIAA03 345 4.02e-119 1..316 1..326
Gene structure Fichier Exons


exon

Literature and cross-references LfluCIIAC01
DNA ref. JGI genome:   scaffold_23 (207395..208477)
Cluster/Prediction ref. JGI gene:   444675
Protein sequence: LfluCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (307)
PWM (Da):   %s   33719.87 (31794.9) Transmb domain:   %s   i13-35o
PI (pH):   %s   9 (8.57) Peptide Signal:   %s   cut: 18 range:18-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSNVVLFASTATALSFPDASVITSLFARKDGSSGSGSGSSGSGSGKCPAVWTSISKELTKKFLTRGECNPDARAAIRLIFHDCGAWNQAQGATGGCDGSLALNAEELGRGENKGLSGI
ANYVKDLAGRWGVGVADAIVFTGTHAIVTCPGGPRVKTYVGRTDSSTAAPNGLLPDVNAPAAELSQLFRDKGFDDVDLAALLGAHSTSNQFNFNTSADKVGLPQDSTPGVWDVKYYSETL
KPPKGVVVFPSDTKLANYQGVGKEFKGFVGNAGKWNGKFADAMGKMALFGSSGTSGLTDCTDSLPKATSSKRDLKAMNPFKPRY*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns
DNA
Send to BLAST
CDS
Send to BLAST