Entry information : LuGPx221
Entry ID 12239
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx221
Name LuGPx221
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx221
start..stop
S start..stop
LuGPx142 336 2.03e-120 1..174 1..173
PtGPx02 292 3.41e-103 7..169 2..164
CclGPx02 282 1.1e-98 2..169 34..201
HbGPx02 276 6.37e-97 7..169 2..164
Gene structure Fichier Exons


exon

Literature and cross-references LuGPx221
DNA ref. Phytozome 12:   scaffold145 (394998..397352)
Protein sequence: LuGPx221
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181
PWM (Da):   %s   19878.08  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADSSSSSSSPNSIYDFTVKDIKGSGVSLSEYKGKVLLIVNVASKCGLTHANYKELNMLYQKYKDGLEILAFPCNQFGGQEPGTIDQIQDTVCTIFKAEFPIFDVDVNGKNTAEVYRYLK
SEKGGFLGDAIKWNFTKFLVNKQGKVMERYAPTTSPLKIEKDIQNLLEIASASDSISSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction.
DNA
Send to BLAST
CDS
Send to BLAST