Entry information : LuPrx222
Entry ID 12240
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2013-10-24 (Qiang Li)
Peroxidase information: LuPrx222
Name LuPrx222
Class Class III peroxidase     [Orthogroup: Prx023]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx222
start..stop
S start..stop
LuPrx139 636 0 15..330 19..334
MePrx135 457 3e-163 1..329 4..328
PpePrx79 448 1e-159 3..329 4..332
PtPrx97 445 1e-158 24..329 7..309
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 243872..244087 216 N° 2 244190..244372 183 N° 3 244476..244641 166 N° 4 245503..245930 428
join(243872..244087,244190..244372,244476..244641,245503..245930)


exon

Literature and cross-references LuPrx222
DNA ref. Phytozome 12:   scaffold145 (243872..245930)
Protein sequence: LuPrx222
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (305)
PWM (Da):   %s   34990.54 (32453.3)  
PI (pH):   %s   5.71 (6.12) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
STSSASLTILLSLLMISCMATNVEAQLRADYYASTCPKLAQIVRREVMNAIKAETRMAASLLRLHFHDCFVNGCDGSLLLDGSDSEKLARPNLNSARGFEVVDSIKTAVESQCSGVVSCADILALASRDSVLLSGGPSWKVPLGRRDGLVANQTAANGLPGPFDNLTLIVTKFAAVGLDDISDVISLSGGHTIGQAKCATFSNRLVNFSQTGSPDPTMESNLVAELQTLCPVNGDGNVTTAFDKGSTDLFDNHYFQNLVNNKGILTSDQVLFSGNEAATAAARNLVQIYSVNQFRFMGDFVKSMIRMGNIGPITGSDGEIRKNCRVVNSG

Retrieve as FASTA  
Remarks Partial sequence from genomic. No prediction. 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTACTTCATCAGCATCATTGACCATACTATTGTCGCTGCTGATGATCTCGTGTATGGCTACGAATGTCGAAGCCCAACTAAGAGCCGACTACTATGCATCAACGTGCCCGAAACTTGCA
CAAATCGTGCGTAGGGAAGTGATGAATGCAATCAAGGCCGAAACCCGGATGGCAGCCTCCTTGCTCCGCCTTCATTTCCACGATTGCTTTGTCAAC
GTACGTATGATTTCATATTCGTTG
TTGATGTTGTTTTTTCGATCTAATTATTATCGGTGTTAGCGAATGAACATATATAATTGTTGTTGTGTCGTTTTTCAGGGATGTGACGGTTCTCTTTTGTTGGATGGGAGTGACAGTGAG
AAGTTAGCGAGGCCTAACTTGAACTCGGCCAGGGGGTTCGAAGTTGTGGACTCGATCAAAACGGCAGTGGAAAGCCAGTGCAGTGGTGTCGTATCTTGTGCTGACATTCTTGCCTTGGCT
TCCCGCGATTCCGTGCTCTTG
GTATAGTAACTAACTAGATCAACAAACCTATTATTGACTTTGTTTGTTTCTTCAACTTGTTGGGCTTTGCTAAGATATCCAAAAATCCTAATTTAACGT
GCAGAGTGGAGGCCCGTCGTGGAAAGTGCCGCTAGGGAGAAGAGATGGGCTTGTGGCTAATCAGACTGCTGCTAATGGGCTACCAGGCCCATTTGATAACCTAACACTCATAGTGACCAA
GTTTGCAGCAGTTGGCCTTGATGATATCTCTGATGTCATCTCCTTGTCAG
GTAATCTCTATACTAGTCTTTTATGATTAAAAATCCATGTTTTACCCTTTTTGAATTTTGATCGAGCCTC
CTGGTTATCGAGTTGAGTTGTTAGTTAGATAAATGATCGAACCATGTCCACCGGACCGTCTGATTAAAAATCCACTAAAATATGTTATCTTTTTCAAATTTTGATCGAGCCTCGTAGTTA
TTCATTCAAGTTGTCGGTTAGACAAATAATCGAACTAGGTGTCCACCAAATCGTCTCTTAGCTCGGATTAAAATGTTACTATTTCAAATTTTTGTTCAACCACTTGATTAGCCATTCGAG
TTATCGGTTAGACAAATGATTGATCCATGTCCATGCATCAAACTGTCTTTTATGATTAAAAATTCACTATTATATGTTGTCTTTTCTGAATTAGGATCGAGCTTTTTGTCTATCCATTTG
AGCGATGAGTCAAAAAAATGATCAAATAATGTCCACTAAACCGTCTCCTACGATAATAAAAAAAGTAAAAAAAGTAACTATTATATATAACCCTTTTCGAATTTGGATCAAACATCTTGG
TTATCCATTTGAACAATCAATTATACAAATAATCAAACCATGCCCACCAATGACCAAACCATATCTCTTATGATTAGAATATTACTCTTTTTTTATTTTGATTGAGTCTCCTAGTTATCC
ATTCGAGCTATCAGTTAGACAAATGATCGAATCATGCCCATCAAACCATTTTTTTTATTAAACATCCACTATTCTATGTTACCTTTTTCGAATTTTGCCCAGTCTCCTGCTTATCCGTTC
GAGTTGTCGTTTAGGAAAAATGATCGAACCACTAACCAACCGAAAATAACAGAAAATTTCGGATCCTGTAGGTGGGCACACAATTGGACAAGCAAAATGTGCTACGTTCAGCAACAGGCT
GGTCAACTTCAGTCAAACCGGGTCCCCGGATCCGACAATGGAGTCCAACTTAGTCGCCGAACTCCAAACCTTGTGTCCGGTGAACGGCGACGGCAACGTCACTACTGCTTTCGACAAGGG
CTCCACCGACTTGTTCGACAACCACTACTTCCAGAACCTCGTCAACAACAAAGGGATTCTGACCTCCGACCAGGTGTTGTTCTCCGGCAACGAGGCCGCCACCGCAGCCGCCAGGAACCT
CGTCCAGATCTACAGCGTCAATCAGTTTCGGTTCATGGGCGACTTCGTCAAATCGATGATTCGGATGGGGAACATTGGTCCGATTACTGGGTCGGACGGTGAGATCAGGAAGAATTGTAG
GGTGGTTAATTCAGGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTACTTCATCAGCATCATTGACCATACTATTGTCGCTGCTGATGATCTCGTGTATGGCTACGAATGTCGAAGCCCAACTAAGAGCCGACTACTATGCATCAACGTGCCCGAAACTTGCA
CAAATCGTGCGTAGGGAAGTGATGAATGCAATCAAGGCCGAAACCCGGATGGCAGCCTCCTTGCTCCGCCTTCATTTCCACGATTGCTTTGTCAAC
GGATGTGACGGTTCTCTTTTGTTG
GATGGGAGTGACAGTGAGAAGTTAGCGAGGCCTAACTTGAACTCGGCCAGGGGGTTCGAAGTTGTGGACTCGATCAAAACGGCAGTGGAAAGCCAGTGCAGTGGTGTCGTATCTTGTGCT
GACATTCTTGCCTTGGCTTCCCGCGATTCCGTGCTCTTG
AGTGGAGGCCCGTCGTGGAAAGTGCCGCTAGGGAGAAGAGATGGGCTTGTGGCTAATCAGACTGCTGCTAATGGGCTACCA
GGCCCATTTGATAACCTAACACTCATAGTGACCAAGTTTGCAGCAGTTGGCCTTGATGATATCTCTGATGTCATCTCCTTGTCAG
GTGGGCACACAATTGGACAAGCAAAATGTGCTACG
TTCAGCAACAGGCTGGTCAACTTCAGTCAAACCGGGTCCCCGGATCCGACAATGGAGTCCAACTTAGTCGCCGAACTCCAAACCTTGTGTCCGGTGAACGGCGACGGCAACGTCACTACT
GCTTTCGACAAGGGCTCCACCGACTTGTTCGACAACCACTACTTCCAGAACCTCGTCAACAACAAAGGGATTCTGACCTCCGACCAGGTGTTGTTCTCCGGCAACGAGGCCGCCACCGCA
GCCGCCAGGAACCTCGTCCAGATCTACAGCGTCAATCAGTTTCGGTTCATGGGCGACTTCGTCAAATCGATGATTCGGATGGGGAACATTGGTCCGATTACTGGGTCGGACGGTGAGATC
AGGAAGAATTGTAGGGTGGTTAATTCAGGTTGA

Retrieve as FASTA