Entry information : LuRboh[P]232
Entry ID 12249
Creation 2013-05-30 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang Li)
Peroxidase information: LuRboh[P]232
Name LuRboh[P]232
Class Respiratory burst oxidase homolog     [Orthogroup: Rboh001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuRboh[P]232
start..stop
S start..stop
PtRboh06 1046 0 36..637 182..909
PtRboh06 53 0.000000251 3..75 24..121
LuRboh[P]218 1033 0 11..637 1..631
PtRboh07 1020 0 36..637 182..909
PtRboh07 45 0.0000967 3..75 24..121
CclRboh05 998 0 29..637 189..929
CclRboh05 55 0.0000000537 1..89 24..138
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12249' 'complement(join(505951..506057,506648..506957,507072..507223,507673..507735,507840..507928,508052..508173,508493..509233,509397..509507,509672..509719,509915..509971,510394..510468,510541..510570))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 510541..510570 28 N° 2 510394..510468 73 N° 3 509915..509971 55 N° 4 509672..509719 46
N° 5 509397..509507 109 N° 6 508493..509233 739 N° 7 508052..508173 120 N° 8 507840..507928 87
N° 9 507673..507735 61 N° 10 507072..507223 150 N° 11 506648..506957 308 N° 12 505951..506057 105
complement(join(505951..506057,506648..506957,507072..507223,507673..507735,5078 40..507928,508052..508173,508493..509233,509397..509507,509672..509719,509915..5 09971,510394..510468,510541..510570))


exon

Literature and cross-references LuRboh[P]232
DNA ref. Phytozome 12:   scaffold38 (510570..505951)
Protein sequence: LuRboh[P]232
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   635 (304)
PWM (Da):   %s   71454.99 (32959.5) Transmb domain:   %s   o143-162i283-305o325-347i471-488o
PI (pH):   %s   8.73 (8.39) Peptide Signal:   %s   cut: 19 range:19-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PNSGPLSGPLYVEITLDLRDDSVAVHSVKAANGTEIGMKESKEFALELYDTLARVDKDADGRITEEEVKEIITLSASANKLSTIQKQAEEYAALIMEELDPEHHGYILSKLLSQKLKPTL
DENPISRWLRDAKYFLLDNWQRVWVMALWIGVMAGLFAYKYVQYRNRAAYEVMGACVCLAKGAAETLKLNMALILLPVCRNTITWLRNKTKLGLAVPFDDNLNFHKVIAVAITIGVGIHG
ISHLACDFPRLLDASDEKWELMEPFFGDQxPSSYWHFVKSKEGVTGIVMVILMAIAFTLATPWFRRNKLxNLPPLLKKLTGFNAFWYSHHLFVIVYTLLVVHGYYLYLTKEWYKKTL*VA
IYPGNVLALHMSKPSGFRYKSGQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLRSVFL*VCQPPATGKSGLLRADVVGSFPKILIDGPYGAPAQDYKQYEVVLLVGLG
IGATPMISIVKDIVNNMKFRTRRAYFYWVTREQGSFDWFKGVMNEVAELDQNQVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVFKQVAVHHPHSR
VGVFYCGAPGLTKELRNLALDFSHKTTTKFDFHKENF

Retrieve as FASTA  
Remarks Pseudogene from genomic. 5' end is missing . Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCGGGCCATTAAGCGGTCCACTGAACAAAAAAGGTGGAAGAAAGAGCGCCAGGTTCAACATACCTGCTGATCAGACTAGCTCGTCCGACCAGCAGTATGTTGAGAGATCACGCTCGATC
TCAGAGATGATTCGGTGGCCGTTCACAGCGTTAAAGCTGCCAACGGCACGGAGGAAGAT
CCCGAGATGACACTTCTAGCCAAAGGCTTGGAGAAGCGCACGGCTTCCAATCTTGGTTCAT
CTGCGATGAGAAGTGCTTCTGCTCGAATCCGTCAAGTTTCTCAAGAGCTGAGGCGGCTCACTTCCATTAACAAAAGGCCCACGGGTCGGCTTGACAGGACCAAGTCGGCAGCGGCTCATG
CTCTCAAGGGTCTCAAGTTCATCAGTAAGGCCGACGGTGGCTCCGGATGGGTTGCTGTGGAGAAGAGGTTCGATGAAATCACCGATGGGATGCTTCCTCGCTCTCGCTTTGGGGAATGCA
TTGGTATGGCATGCATACCAACTGTTTGACAACTTGTCACTTCTGAGAATTATATTAAAGAGATCCATGATCAAGTTCTAAATTATTATGCTTGTGTGTATCTTGTTAATCTTTGATAGG
AATATGAAGGAGTCAAAGGAATTCGCCTTGGAGTTGTATGATACTCTCGCTAGGAAGAGAAACATTCAGAGGGATTCAATCACCAAGTCTGAGTTGAAGGACTTCTGGGATCAGATTTCC
AACCAGAGCTTCGATTCCAGGCTCCAGACTTTCTTTGACATGTACTAAATTACCTCTTTTGTCCTTCTTGGTTAAATTGGGAACACAAAGTCAATGTTGGGCAATTTATATTGTGAAAAT
TATTTCAGGGTTGATAAAAGGATGCAGATGGTAGAATTACTGAAGAGGAAGTTAAGGAGGTATGTATACCATTGGAATATCATTTTGAAGGGTTGACTTGACGACTAACGTGGTTTTTGG
AGGGAATTGTGGCATGTGCTTGAGATGAGAGGTGGATTTCGTCTGAAGATTTCCCCTTTTTTGTTTTTTGTTTTAATTTTAATTTTAATGAATATTTTGGCAGATCATTACACTCTCAGT
GCATCTGCAAACAAGCTTTCGACTATCCAAAAACAAGCAGAGGAGTATGCTGCTTTGATTATGGAAGAATTGGATCCTGAACACCATGGATACATCATGGTA
ATGTAGAATTTGATCTCT
TTGATAGCACCATGCATATATAGAGTAGCAGTAGTAGGTGTCCTGAATGGGTCCGTTTGATTACAAACAGATAGAGAGCTTGGAAATGCTGTTGCTGCAAGGACCAAGCCAGTCTGTTAG
AGCAGCAGACAGCAAGAACCTGAGCAAAAACTGTTGAGCCAGAAGCTAAAGCCGACACTGGACGAGAACCCAATCAGTAGATGGTTGAGAGACGCGAAATACTTTTTATTGGACAACTGG
CAGAGAGTTTGGGTGATGGCTCTGTGGATTGGGGTAATGGCTGGCCTATTTGCTTATAAGTACGTGCAATATCGCAACAGAGCTGCATACGAGGTCATGGGCGCTTGTGTCTGCCTAGCT
AAAGGTGCTGCCGAAACACTCAAACTAAATATGGCTTTGATTCTGCTTCCTGTCTGCCGGAACACAATCACATGGCTCAGGAATAAGACCAAACTAGGACTTGCTGTTCCTTTTGATGAC
AACCTCAACTTTCACAAGGTTATAGCGGTGGCAATAACAATTGGAGTAGGCATCCATGGCATATCCCATTTGGCCTGTGACTTTCCTCGTCTTCTAGATGCAAGCGATGAGAAATGGGAA
CTTATGGAGCCATTTTTTGGAGACCAGNNNCCGTCGAGCTACTGGCATTTCGTTAAGTCAAAGGAAGGGGTCACTGGGATTGTGATGGTTATTCTGATGGCGATAGCTTTCACACTTGCC
ACTCCTTGGTTCAGGCGAAACAAGCTCNNNAATTTGCCACCTTTGTTGAAGAAGCTAACAGGATTCAATGCCTTTTGGTACTCCCACCATTTGTTTGTCATTGTCTACACTCTGCTTGTA
GTTCACGGTTACTATCTCTACCTCACCAAGGAATGGTACAAGAAGACA
GTAAGTGCTGCGGAACCTTTAATTTTTATTCCCCTGCTATATATATGGATTCCGTAATGAAACCTGAGCAGC
CTTTAATTGGGAACTCTTACAAAATTTCAGACCTGGATGTACTTGGCTGTTCCAGTAGTTCTTTATGGCAGCGAGAGGTTGACAAGGGCATTGAGGTCCAGCATCAAGGCAGTTACCATA
AGGAAGGTAATTTGATTTGTCCAACCACACGCAGTACAGGAAAGTACAGTAGTCCATTTAACATCTCATTAAAGAAATACAAAGCAGGAGAGGATGAGCACTGAAACCCGGTTTAATTTG
TGGTTATTTTTATAGGTGGCAATTTATCCTGGAAACGTGTTGGCACTTCACATGTCAAAGCCTAGTGGGTTCAGATACAAGAGTGGGCAGTACATGTTTGTGAATTGTGCTGCAGTGTCT
CCATTTGAATG
GTACTAATTAATTAAGGAGCATTATCTCTTTTAAATGACTCTTTTAAGATTTGACATTACGATCCAGTAAATGAGCCCTTTAACTTTATGGTTTTGACTGACGAATTTG
TGAATATCCAACAGGCGCACCCATTCTCCATCACTTCTGCTCCCGGAGATGATTATTTGAGCGTTCACATCAGAACACTGGGTGACTGGACGAGGCAGCTCAGAACTGTTTTCCAAGAGG
TACTACAGAATTATATGACTACTTGTCTATGTTTTGTAAAGTAAGATGCATGTTTGCCTAGGACTTGTATAATTTTGTAATTTCTCTTGGCGCGTCTTTTTATAGGTGTGTCAACCACCG
GCGACAGGGAAGAGTGGACTTCTCAGAGCGGATG
GATTTCAGGGAAACAACAATCCTGAGTAAGTTGTAATTTTTGAAGTAGCTAATTGATGATACTGACATTGACAACAGTGAGTGATA
GATTATAATAAGCTGGCCCTTGAAAAATAAGGGCGGAAAACGACAAACCAAAACAACTCATTTTCTGACCATTTCAAAGAGCTAGGGAGCATTGATTTACACCAAAACACAAAATTGCTG
TCTTTCTTAGTATTTGGTGTTTGTACACTTTGATGATGATTGATGAAGACCGCCATATATTAATGTCATCAGCCAAAATCCATGTTGCTTTCATAATAAAAAAAGAACAGATGATGAAGC
ATCATAGGTGCTGCTAAATACTAAAAGTTATGGGCATGATTATATAGCTAGCTCCAACCACAAAACGGCTGTCTTTTTCTGTTGCTACAAATAAATAAACTCTTAAGTGTGTTATAATAA
TGTTTTTGTTGGCAGTTTTCCAAAAATATTGATCGACGGACCATATGGAGCTCCGGCACAAGATTACAAACAATACGAAGTTGTTCTGCTAGTGGGACTGGGGATAGGAGCCACACCCAT
GATCAGCATTGTCAAGGACATAGTAAACAACATGAAG
GCCATGGATGACTTGGAGAACGGCGCAACAACTGCACCCAGTGCCGCGTCGCCTCCTTCAATAAGCCACCAATCTGGCTCGTC
CTCACACTCCAACAGTAAGAGGAAAGAACAGTTTTCAGGACTAGAAGGGCCTACTTTTATTGGGTAACAAGGGAGCAAGGCTCCTTCGACTGGTTTAAAGGTGTGATGAACGAGGTTGCT
GAATTGGATCAAAACCAAGTGATAGAGCTCCATAACTACTGCACCAGTGTGTACGAAGAGGGAGATGCACGTTCTGCACTCATTGCTATGCTCCAATCCCTTCACCACGCTAAAAACGGG
GTTGACATTGTCTCGGGGACACGTGTCAAATCCCACTTCGCCAAACCCAACTGGCGTAACGTTTTCAAGCAAGTTGCCGTTCACCATCCTCATTCCCGAGTTG
GTACGTACATCATCATC
ATCATCCATTGGTTATGTTATGTTTTTGTTTTTAGTTTCTCAGGATAGAATTATTTTGTTCCACAACGAAATCATCATCCCTTGGTTATGTTTTGTTCAAATGAAAAAAACCATCATCTA
TATATGCAGCAATGCACATGACAATAATACAGGGCAGACAAGTAGGGATAATCATTTGGGGAATGCTTTCGTCTCCCTGTTCATTCTGCTCATCAAAATAATTAAAAAAAACCCTAAAAT
AATATATAATTTTTCTTATTATATCCTAATAACTCGAGTGGTTAGAAAATAGTTATTATAAATCGTATATCATCCGCTCATATAACAACACATAATAATAGCATAATAATAGCTGTAGGT
CCAAAATGAGAGTGCTTTGTGTCATATCATGGAGCCTTTTGGAAAATCAATCAGTGTACTCTTCCCTCTTATTGTAATCTTCTAGAATTTCAAAGGTGTTTTATGGGTGGGTGATACTTC
CACTAACAATGCTTGGTTGACAAGTAATAAGCCACTAATTAGATGGTTAATAATTTATGATAGTGGTTGATTATGATACTGCTGCTACTGCAGGGGGGTGTTTTATTGTGGGGCACCTGG
ATTGACAAAGGAGCTCCGCAACTTGGCTCTGGATTTCTCGCATAAGACCACCACCAAGTTTGATTTCCACAAGGAGAACTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCGGGCCATTAAGCGGTCCACTGAACAAAGAGATCACGCTCGATCTCAGAGATGATTCGGTGGCCGTTCACAGCGTTAAAGCTGCCAACGGCACGGAGGAAGATATGAAGGAGTCAAAG
GAATTCGCCTTGGAGTTGTATGATACTCTCGCTAGGAAGAGA
AAGGATGCAGATGGTAGAATTACTGAAGAGGAAGTTAAGGAGGTATGTACTCTCAGTGCATCTGCAAACAAGCTTTCG
ACTATCCAAAAACAAGCAGAGGAGTATGCTGCTTTGATTATGGAAGAATTGGATCCTGAACACCATGGATACATCATGGTA
AAACTGTTGAGCCAGAAGCTAAAGCCGACACTGGACGAG
AACCCAATCAGTAGATGGTTGAGAGACGCGAAATACTTTTTATTGGACAACTGGCAGAGAGTTTGGGTGATGGCTCTGTGGATTGGGGTAATGGCTGGCCTATTTGCTTATAAGTACGTG
CAATATCGCAACAGAGCTGCATACGAGGTCATGGGCGCTTGTGTCTGCCTAGCTAAAGGTGCTGCCGAAACACTCAAACTAAATATGGCTTTGATTCTGCTTCCTGTCTGCCGGAACACA
ATCACATGGCTCAGGAATAAGACCAAACTAGGACTTGCTGTTCCTTTTGATGACAACCTCAACTTTCACAAGGTTATAGCGGTGGCAATAACAATTGGAGTAGGCATCCATGGCATATCC
CATTTGGCCTGTGACTTTCCTCGTCTTCTAGATGCAAGCGATGAGAAATGGGAACTTATGGAGCCATTTTTTGGAGACCAGNNNCCGTCGAGCTACTGGCATTTCGTTAAGTCAAAGGAA
GGGGTCACTGGGATTGTGATGGTTATTCTGATGGCGATAGCTTTCACACTTGCCACTCCTTGGTTCAGGCGAAACAAGCTCNNNAATTTGCCACCTTTGTTGAAGAAGCTAACAGGATTC
AATGCCTTTTGGTACTCCCACCATTTGTTTGTCATTGTCTACACTCTGCTTGTAGTTCACGGTTACTATCTCTACCTCACCAAGGAATGGTACAAGAAGACA
TTATAGGTGGCAATTTAT
CCTGGAAACGTGTTGGCACTTCACATGTCAAAGCCTAGTGGGTTCAGATACAAGAGTGGGCAGTACATGTTTGTGAATTGTGCTGCAGTGTCTCCATTTGAATG
GCACCCATTCTCCATC
ACTTCTGCTCCCGGAGATGATTATTTGAGCGTTCACATCAGAACACTGGGTGACTGGACGAGGCAGCTCAGAA
GCGTCTTTTTATAGGTGTGTCAACCACCGGCGACAGGGAAGAGTGGA
CTTCTCAGAGCGGATG
TTGTTGGCAGTTTTCCAAAAATATTGATCGACGGACCATATGGAGCTCCGGCACAAGATTACAAACAATACGAAGTTGTTCTGCTAGTGGGACTGGGGATAGGA
GCCACACCCATGATCAGCATTGTCAAGGACATAGTAAACAACATGAAG
TTCAGGACTAGAAGGGCCTACTTTTATTGGGTAACAAGGGAGCAAGGCTCCTTCGACTGGTTTAAAGGTGTG
ATGAACGAGGTTGCTGAATTGGATCAAAACCAAGTGATAGAGCTCCATAACTACTGCACCAGTGTGTACGAAGAGGGAGATGCACGTTCTGCACTCATTGCTATGCTCCAATCCCTTCAC
CACGCTAAAAACGGGGTTGACATTGTCTCGGGGACACGTGTCAAATCCCACTTCGCCAAACCCAACTGGCGTAACGTTTTCAAGCAAGTTGCCGTTCACCATCCTCATTCCCGAGTTG
GG
GTGTTTTATTGTGGGGCACCTGGATTGACAAAGGAGCTCCGCAACTTGGCTCTGGATTTCTCGCATAAGACCACCACCAAGTTTGATTTCCACAAGGAGAACTTC

Retrieve as FASTA