Entry information : CgeoCcP02
Entry ID 12268
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: CgeoCcP02
Name CgeoCcP02
Class Cytochrome C peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Cenococcum
Organism Cenococcum geophilum    [TaxId: 5570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgeoCcP02
start..stop
S start..stop
RrufCcP01 188 1.58e-59 5..212 75..318
BdotCcP02 187 6.63e-59 5..212 76..319
ApruCcP02 180 2.49e-56 5..213 75..319
BcomCcP 177 2.98e-55 5..213 75..321
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12268' 'complement(join(1407661..1407849,1407893..1408028,1408088..1408401))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1408088..1408401 312 N° 2 1407893..1408028 134 N° 3 1407661..1407849 187  
complement(join(1407661..1407849,1407893..1408028,1408088..1408401))


exon

Literature and cross-references CgeoCcP02
DNA ref. JGI genome:   scaffold_2 (1408401..1407661)
Cluster/Prediction ref. JGI gene:   672851
Protein sequence: CgeoCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212 (307)
PWM (Da):   %s   22932.65 (33723.2)  
PI (pH):   %s   10.42 (9.30) Peptide Signal:   %s   cut: 28 range:28-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLPRVFLEPAKAAHPWITYSDLWTLAGCVSTEAMGAKSTDSPAAPTASMTLNSHLGGLPDGAKGADHVRSVFMRMGFNDQEIVALSGAHNLGRCHTKRSGFEGKVEAKEARQRRAPVCA
RRRGLGRGADDVADRYGAPDGPELQRVGDAAFTKLMGLGIQRDAQGKVVNSDNLKVRYHSAPKKANKPGLPNASNEETKPLRMENERFRARL*

Retrieve as FASTA  
Remarks incorrect sequence from genomics (2 introns). missing 5' end.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTTCCACGCGTCTTTCTCGAGCCAGCCAAGGCAGCCCACCCATGGATAACATACTCAGACCTCTGGACACTCGCCGGCTGCGTCTCCACTGAAGCTATGGGAGCCAAGTCAACT
GACTCCCCAGCCGCACCGACTGCATCGATGACTCTAAACTCCCACCTCGGGGGACTTCCAGACGGCGCAAAAGGCGCAGACCATGTGCGGAGCGTGTTCATGCGGATGGGATTCAACGAC
CAGGAGATCGTGGCACTATCCGGAGCACATAATCTAGGCCGTTGCCATACCAAACGCAGTGGGTTTGAGGGAAA
GTGGGTGCATAGCCCGACGCGGTTCAGCAACCAGTACTTCCGGCTG
CTGACGCGGCTAGAGAGTAGAAGCCAAAGAAGCTAGACAACGGCGTGCTCCAGTTTGTGCACGTAGACGAGGACTTGGGCGAGGAGCTGATGATGTTGCCGACAGATATGGCGCTCCTGA
CGGACCCGAGCTTCAAAGAGTGGGCGATGCG
GTACGCGGATGACAAGGAAGCCTTTTACGCAGACTTTGCGAAGGCGCGTTTACGAAATTGATGGGGCTGGGGATTCAGAGGGATGCGCA
GGGGAAGGTGGTCAATTCGGACAATTTGAAGGTCAGATATCATTCTGCGCCGAAGAAAGCGAACAAGCCAGGACTGCCTAATGCGTCTAACGAGGAGACTAAGCCTCTACGGATGGAAAA
TGAGAGGTTTAGGGCGAGGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTTCCACGCGTCTTTCTCGAGCCAGCCAAGGCAGCCCACCCATGGATAACATACTCAGACCTCTGGACACTCGCCGGCTGCGTCTCCACTGAAGCTATGGGAGCCAAGTCAACT
GACTCCCCAGCCGCACCGACTGCATCGATGACTCTAAACTCCCACCTCGGGGGACTTCCAGACGGCGCAAAAGGCGCAGACCATGTGCGGAGCGTGTTCATGCGGATGGGATTCAACGAC
CAGGAGATCGTGGCACTATCCGGAGCACATAATCTAGGCCGTTGCCATACCAAACGCAGTGGGTTTGAGGGAAA
AGTAGAAGCCAAAGAAGCTAGACAACGGCGTGCTCCAGTTTGTGCA
CGTAGACGAGGACTTGGGCGAGGAGCTGATGATGTTGCCGACAGATATGGCGCTCCTGACGGACCCGAGCTTCAAAGAGTGGGCGATGCG
GCGTTTACGAAATTGATGGGGCTGGGGATT
CAGAGGGATGCGCAGGGGAAGGTGGTCAATTCGGACAATTTGAAGGTCAGATATCATTCTGCGCCGAAGAAAGCGAACAAGCCAGGACTGCCTAATGCGTCTAACGAGGAGACTAAGCCT
CTACGGATGGAAAATGAGAGGTTTAGGGCGAGGCTGTGA

Retrieve as FASTA