Entry information : DcryGPx02
Entry ID 12284
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: DcryGPx02
Name DcryGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Dioszegia
Organism Dioszegia cryoxerica    [TaxId: 603311 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DcryGPx02
start..stop
S start..stop
DcryGPx03 376 6.07e-136 1..185 1..185
CgaGPx02 281 3.3e-98 7..183 11..185
CnGPx02_JEC21 278 5.88e-97 7..183 11..185
CnGPx02_grubiiH99 275 4.82e-96 7..183 11..185
Gene structure Fichier Exons


exon

Literature and cross-references DcryGPx02
DNA ref. JGI genome:   scaffold_30 (170769..169937)
Cluster/Prediction ref. JGI gene:   334913
Protein sequence: DcryGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   184
PWM (Da):   %s   19873.97 Transmb domain:   %s   i7-26o
PI (pH):   %s   6.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYINILGFETVPASAKGKSFYDLKASLPGSKGDYDFANLKGKAVLIVNTASKCGFTPQYTGLEELHKTYHDKGLEVLGFPSNEFGGQDPGTDDEIASFCQVNHGVTFPLMKKSEVNGNN
MNDVFAWLKANGAEVAGAGGVAGTTSIKWNFTKFLVDRNGHVVGRYSPSTKPETLKAEIEKLLQ*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
CDS
Send to BLAST