Entry information : ParcLiP05
Entry ID 12294
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2018-01-18 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-01-18 (Catherine Mathe)
Peroxidase information: ParcLiP05
Name ParcLiP05
Class Lignin peroxidase    [Orthogroup: LiP004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Polyporus
Organism Polyporus arcularius    [TaxId: 5639 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ParcLiP05
start..stop
S start..stop
ParcLiP02 713 0 1..365 1..365
ParcLiP01 680 0 1..364 1..364
ParcLiP04 678 0 1..365 1..365
ParcLiP03 630 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6045..6105 61 N° 2 6161..6500 340 N° 3 6550..6671 122 N° 4 6726..7222 497
N° 5 7280..7344 65 N° 6 7398..7410 13  
join(6045..6105,6161..6500,6550..6671,6726..7222,7280..7344,7398..7410)


exon

Literature and cross-references ParcLiP05
DNA ref. JGI genome:   scaffold_193 (6045..7410)
Cluster/Prediction ref. JGI gene:   663043
Protein sequence: ParcLiP05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (344)
PWM (Da):   %s   39008.7 (36805.5)  
PI (pH):   %s   4.66 (4.60) Peptide Signal:   %s   cut: 22 range:22-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKALLSFVSIVAAIQGATAALTRRVACPDGKNTATNAACCALFPIRDDIVKNLFHNQCAEEAHESLRLTFHDAVAFSPAAQARGQFAGGGADGSIVLFSEIETAFHANGGTDEIVALQKPFIAKHNISAADFVQFAGAVGLAQCPGAPQLEFKLGRKDATRAAPDGLVPEPFDSVDKILARLLDVGFQDFEVVWLLSAHTVAAADLVDPTIPRTPFDSTPEIFDTQFFIETQLRGQTFPGKGGIQGEVTSPLRGEMRLQSDHLLARDSRTSCEWQSFTNDQEKFAETFPDVMGRLALLGVDESKLIDCSEVIPLAPPLPANIRPHFPAGKTHADIEQACAETPFPSFPTDPGPATVVAPVPNL*

Retrieve as FASTA  
Remarks complete sequence from genomics ( 5 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGGCTCTGCTCTCCTTCGTCTCCATCGTCGCCGCCATTCAGGGTGCCACCGGTACATTTACCTCGCCCCTCTACTCTGTTCTTACACTCATGCGCCCGTTATTTAGCTGC
GCTCACCCGGCGCGTCGCTTGCCCCGACGGCAAGAACACTGCGACCAATGCGGCGTGCTGCGCCCTCTTCCCCATACGGGACGACATCGTGAAGAACCTCTTCCACAACCAGTGCGCAGA
GGAGGCCCACGAGTCCCTCCGCCTCACCTTCCACGACGCCGTCGCGTTCTCGCCCGCTGCCCAAGCCCGTGGCCAGTTCGCCGGTGGAGGCGCCGACGGCTCCATCGTTCTCTTCTCCGA
GATCGAGACGGCCTTCCACGCGAACGGAGGCACCGACGAGATCGTCGCGTTGCAGAAGCCCTTCATCGCCAAGCATAACATCTCCGCCGCTGACTT
GTAAGTTGCCCTTCTCTTGTTTCC
GTGCAGGTACTGACGTGCTTTGTAGCGTTCAATTTGCGGGTGCTGTCGGGCTCGCTCAGTGCCCCGGTGCACCTCAGCTCGAGTTTAAGCTCGGCCGCAAGGACGCAACCCGGGCTGCAC
CTGACGGTCTCGTCCCCGAGCCTTTCG
GTACGTGTATTAGCCTTCCGCTTCATCAGTCGTGTGTCTCATCATCACATCCAGACTCGGTCGACAAGATCCTTGCCCGCTTGCTTGACGTCG
GTTTCCAGGACTTCGAGGTCGTCTGGCTGCTCTCCGCACACACTGTCGCCGCCGCCGACCTAGTCGACCCGACTATCCCGCGCACGCCCTTCGACTCCACTCCGGAAATCTTCGACACCC
AGTTCTTCATCGAGACCCAGCTCCGCGGCCAGACCTTCCCCGGTAAGGGCGGCATCCAGGGCGAGGTGACGTCTCCCCTCCGCGGCGAGATGCGCCTGCAGTCCGATCATCTGCTCGCGC
GTGACTCGCGCACGTCTTGCGAGTGGCAGTCGTTCACCAACGACCAGGAGAAGTTTGCGGAGACGTTCCCGGACGTCATGGGCCGCCTTGCGCTCCTCGGTGTGGACGAGAGCAAGCTCA
TTGATTGCTCGGAGGTCATACCGCTCGCCCCGCCCCTCCCGGCCAACATCCGCCCGCATTTCCCTGCCGGAAAGACCCACGCCGACATCGAGCAAGCA
GTGAGTGGCCTACAGTATATTC
GCAGATGGATATACTTGCTGACCAGCCTCTCACAGTGTGCTGAGACGCCGTTCCCCTCGTTCCCAACCGACCCGGGTCCGGCCACTGTCGTCGCTCCTGTGTAAGTCGCCTCTTTCAGAT
TACAACTTATGTGCTGTTCTGACATGACTACAGTCCCAACCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGGCTCTGCTCTCCTTCGTCTCCATCGTCGCCGCCATTCAGGGTGCCACCGCTGCGCTCACCCGGCGCGTCGCTTGCCCCGACGGCAAGAACACTGCGACCAATGCGGCG
TGCTGCGCCCTCTTCCCCATACGGGACGACATCGTGAAGAACCTCTTCCACAACCAGTGCGCAGAGGAGGCCCACGAGTCCCTCCGCCTCACCTTCCACGACGCCGTCGCGTTCTCGCCC
GCTGCCCAAGCCCGTGGCCAGTTCGCCGGTGGAGGCGCCGACGGCTCCATCGTTCTCTTCTCCGAGATCGAGACGGCCTTCCACGCGAACGGAGGCACCGACGAGATCGTCGCGTTGCAG
AAGCCCTTCATCGCCAAGCATAACATCTCCGCCGCTGACTT
CGTTCAATTTGCGGGTGCTGTCGGGCTCGCTCAGTGCCCCGGTGCACCTCAGCTCGAGTTTAAGCTCGGCCGCAAGGAC
GCAACCCGGGCTGCACCTGACGGTCTCGTCCCCGAGCCTTTCG
ACTCGGTCGACAAGATCCTTGCCCGCTTGCTTGACGTCGGTTTCCAGGACTTCGAGGTCGTCTGGCTGCTCTCCGCA
CACACTGTCGCCGCCGCCGACCTAGTCGACCCGACTATCCCGCGCACGCCCTTCGACTCCACTCCGGAAATCTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGCGGCCAGACCTTC
CCCGGTAAGGGCGGCATCCAGGGCGAGGTGACGTCTCCCCTCCGCGGCGAGATGCGCCTGCAGTCCGATCATCTGCTCGCGCGTGACTCGCGCACGTCTTGCGAGTGGCAGTCGTTCACC
AACGACCAGGAGAAGTTTGCGGAGACGTTCCCGGACGTCATGGGCCGCCTTGCGCTCCTCGGTGTGGACGAGAGCAAGCTCATTGATTGCTCGGAGGTCATACCGCTCGCCCCGCCCCTC
CCGGCCAACATCCGCCCGCATTTCCCTGCCGGAAAGACCCACGCCGACATCGAGCAAGCA
TGTGCTGAGACGCCGTTCCCCTCGTTCCCAACCGACCCGGGTCCGGCCACTGTCGTCGCT
CCTGT
TCCCAACCTTTAG

Retrieve as FASTA