Entry information : NlepGPx01
Entry ID 12314
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: NlepGPx01
Name NlepGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Gloeophyllaceae Neolentinus
Organism Neolentinus lepideus    [TaxId: 38799 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NlepGPx01
start..stop
S start..stop
GtraGPx01 332 3.35e-117 1..217 1..221
PstrGPx01 307 5.66e-107 19..216 62..254
DqueGPx01 293 9.19e-103 60..217 3..160
FpinGPx01 292 1.61e-101 1..217 9..229
Gene structure Fichier Exons


exon

Literature and cross-references NlepGPx01
DNA ref. JGI genome:   scaffold_3 (458330..459041)
Cluster/Prediction ref. JGI gene:   1055336
Protein sequence: NlepGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   24178.55  
PI (pH):   %s   10
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRRLPSLLIRLRPLSFVTRSSAQRFAPAHPYYKSLSARLPSRTYATTRVSDPQPTMAQTFYDLKAELPGGKTLDFADLKGKVVLIVNTASQCGFTPQYKGLQKLYEKYKDKDFVILGFP
CNQFGGQEPGDDSAISEFCTLNHGVSFPLMKKSDVNGDNTNEVYKWLKSQKAGILGLTRIKWNFEKFLIDKNGNVVNRWASTTTPDAIDAEVAKLV*

Retrieve as FASTA  
Remarks complete sequence from genomic (4 introns)
DNA
Send to BLAST
CDS
Send to BLAST