Entry information : SsteMnP02
Entry ID 12316
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP02
Name SsteMnP02
Class Manganese peroxidase    [Orthogroup: MnP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP02
start..stop
S start..stop
SsteMnP04 671 0 1..367 1..367
SsteMnP23-2 643 0 1..367 1..367
SsteMnP23-3 639 0 1..367 1..367
SsteMnP23-1 637 0 1..367 1..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 95197..95354 158 N° 2 95091..95143 53 N° 3 94502..95032 531 N° 4 94366..94449 84
N° 5 94140..94311 172 N° 6 93980..94085 106  
complement(join(93980..94085,94140..94311,94366..94449,94502..95032,95091..95143 ,95197..95354))


exon

Literature and cross-references SsteMnP02
DNA ref. JGI genome:   scaffold_35 (95354..93980)
Cluster/Prediction ref. JGI gene:   165991
Protein sequence: SsteMnP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (348)
PWM (Da):   %s   38404.06 (36314.9)  
PI (pH):   %s   4.72 (4.64) Peptide Signal:   %s   cut: 20 range:20-367
Sequence 409
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFKSLISIISLSVFAVQAANFRRVACPDGVHTATNAACCKFFALRDDLQANLFDNQCGEDSHEALRLTFHDAIAFSPALKKQGKPAGGGADGSMLIFPNVEPNFSANNGISDSVDSLTPFLAAHPTISPGDLIQFAGAVGISNCPGAPRLQFMAGRPNATAPAPDGLIPEPNDTITQILARMADGGGFSPDEVVALLSSHSIARADHVDPTLNAAPFDSTPFDFDTQIFVEVLLRGVGFPGKGGNVGEAQSPLPKTDDEDVGEIRLLSDHTFARDSRTACTWQGFVNQQAKMASAFRAAMAKLAVIGQDTSKMIDCSEAVPIPVPSKGKPATFPATKTNADIEQACASAPFPHLATDPGPVESLIP*

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTAAATCCCTCATCTCAATCATTAGTCTATCTGTCTTTGCTGTTCAAGCAGCAAACTTCAGACGTGTCGCCTGTCCTGATGGAGTACACACCGCTACCAATGCTGCGTGCTGT
AAATTCTTTGCTCTCCGTGACGACCTTCAGGCGAACTT
GTATGTGCAGGACACCAACTGATATAATATTTATTGATACAGTAATTATCTAGGTTCGATAATCAATGCGGCGAAGATTCTC
ATGAAGCCCTTCGTCTAACATTCC
GTACGTACCAGACTAGTATTGGGTAGATTCTAGCCTTGACTCATTCATAAAAACTCAGACGATGCAATTGCGTTTTCTCCTGCACTTAAAAAGCAA
GGAAAGCCTGCTGGCGGAGGCGCGGACGGCTCAATGCTCATCTTCCCGAACGTTGAGCCCAACTTCAGTGCAAACAACGGCATCTCCGATTCCGTTGATTCTCTTACTCCATTCCTGGCT
GCACACCCCACCATCAGCCCCGGCGACCTCATCCAATTTGCAGGCGCTGTCGGAATTAGTAATTGTCCTGGGGCTCCTCGTCTGCAGTTCATGGCTGGTCGTCCCAACGCGACTGCTCCG
GCTCCCGATGGTCTTATTCCAGAGCCTAATGACACCATAACACAGATCCTTGCCCGAATGGCTGATGGTGGTGGATTCAGTCCCGATGAGGTTGTTGCCTTGTTGTCATCCCACTCCATT
GCTCGTGCAGACCATGTGGACCCAACATTGAACGCGGCTCCCTTTGACAGCACTCCTTTCGATTTTGACACTCAGATCTTCGTTGAAGTGTTACTCAGGGGTGTTGGATTCCCAGGAAAG
GGAGGCAATGTCG
GTGAGTATTAAATATGATAAACTCAAGAAATATATACTTATAATTTATGCAGGCGAAGCCCAATCACCGTTGCCGAAAACGGATGACGAGGATGTCGGCGAAATTCG
TCTCCTATCTGATCACACTTTTGCTCGTG
GTACGTGAAGATTTACATTATTCATTAATTTCTGCATCTAATGTATTGCGACAGATTCAAGGACTGCATGCACCTGGCAAGGGTTCGTGAA
CCAGCAAGCGAAGATGGCTAGCGCGTTCCGTGCTGCTATGGCTAAACTTGCAGTTATCGGCCAAGACACATCTAAGATGATCGACTGCTCTGAGGCCGTGCCCATCCCTGTCCCTTCTAA
AGGAAAACCCGCGAC
GTTAGGATTATTCGATTTGTAACATGATTGAATTTACTAACACTTGTTAAATAGTTTCCCTGCAACCAAGACTAATGCAGATATTGAACAGGCATGCGCTTCTGC
TCCCTTCCCGCATCTTGCCACCGACCCAGGCCCTGTGGAAAGTTTGATTCCGTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTAAATCCCTCATCTCAATCATTAGTCTATCTGTCTTTGCTGTTCAAGCAGCAAACTTCAGACGTGTCGCCTGTCCTGATGGAGTACACACCGCTACCAATGCTGCGTGCTGT
AAATTCTTTGCTCTCCGTGACGACCTTCAGGCGAACTT
GTTCGATAATCAATGCGGCGAAGATTCTCATGAAGCCCTTCGTCTAACATTCCACGATGCAATTGCGTTTTCTCCTGCACTT
AAAAAGCAAGGAAAGCCTGCTGGCGGAGGCGCGGACGGCTCAATGCTCATCTTCCCGAACGTTGAGCCCAACTTCAGTGCAAACAACGGCATCTCCGATTCCGTTGATTCTCTTACTCCA
TTCCTGGCTGCACACCCCACCATCAGCCCCGGCGACCTCATCCAATTTGCAGGCGCTGTCGGAATTAGTAATTGTCCTGGGGCTCCTCGTCTGCAGTTCATGGCTGGTCGTCCCAACGCG
ACTGCTCCGGCTCCCGATGGTCTTATTCCAGAGCCTAATGACACCATAACACAGATCCTTGCCCGAATGGCTGATGGTGGTGGATTCAGTCCCGATGAGGTTGTTGCCTTGTTGTCATCC
CACTCCATTGCTCGTGCAGACCATGTGGACCCAACATTGAACGCGGCTCCCTTTGACAGCACTCCTTTCGATTTTGACACTCAGATCTTCGTTGAAGTGTTACTCAGGGGTGTTGGATTC
CCAGGAAAGGGAGGCAATGTCG
GCGAAGCCCAATCACCGTTGCCGAAAACGGATGACGAGGATGTCGGCGAAATTCGTCTCCTATCTGATCACACTTTTGCTCGTGATTCAAGGACTGCA
TGCACCTGGCAAGGGTTCGTGAACCAGCAAGCGAAGATGGCTAGCGCGTTCCGTGCTGCTATGGCTAAACTTGCAGTTATCGGCCAAGACACATCTAAGATGATCGACTGCTCTGAGGCC
GTGCCCATCCCTGTCCCTTCTAAAGGAAAACCCGCGAC
TTTCCCTGCAACCAAGACTAATGCAGATATTGAACAGGCATGCGCTTCTGCTCCCTTCCCGCATCTTGCCACCGACCCAGGC
CCTGTGGAAAGTTTGATTCCGTG

Retrieve as FASTA