Entry information : SsteMnP04
Entry ID 12318
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP04
Name SsteMnP04
Class Manganese peroxidase    [Orthogroup: MnP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP04
start..stop
S start..stop
SsteMnP23-2 698 0 1..380 1..380
SsteMnP23-3 694 0 1..380 1..380
SsteMnP23-1 692 0 1..380 1..380
SsteMnP16 686 0 1..380 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 175600..175757 158 N° 2 175811..175863 53 N° 3 175919..176449 531 N° 4 176506..176589 84
N° 5 176645..176816 172 N° 6 176871..176972 102 N° 7 177029..177071 43  
join(175600..175757,175811..175863,175919..176449,176506..176589,176645..176816, 176871..176972,177029..177071)


exon

Literature and cross-references SsteMnP04
DNA ref. JGI genome:   scaffold_53 (175600..177071)
Cluster/Prediction ref. JGI gene:   254089
Protein sequence: SsteMnP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (361)
PWM (Da):   %s   39692.21 (37730.1)  
PI (pH):   %s   4.14 (4.16) Peptide Signal:   %s   cut: 20 range:20-380
Sequence 422
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFASLIVFIGISVAAVQAANFRRITCPDGVNTATNAACCAFFALRDDLQANLFDNQCGEDAHESLRLTFHDAIAFSPSLKQQGKPAGGGADGSMLIFPDVEPNFHANNGISDSVDALTPFLAAHNTISAGDLIQFAGAVAITNCPGAPRLQFMAGRPNATAPAPDGLIPEPQDTITSILARMEDGGGFTPDEVVALLASHSIARADHVDPTLNAAPFDSTPFDFDTQIFVEVLLRGVGFPGTGGNQGEAESPLPRTDEEDVGELRLLSDQTFARDSRTACTWQGFVNQQAKMASAFGAAMAKLAVIGQDTSKMIDCSEVVPIPKPATGKPATFPATKTNADIEQACASSPFPHLATDPGPVESLIPHCPDGSEDDCDDS*

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGCTTTGCATCTCTCATCGTGTTCATTGGCATCTCTGTTGCAGCTGTTCAAGCAGCAAACTTCAGGCGTATTACCTGCCCCGATGGCGTTAACACTGCCACCAACGCTGCCTGCTGTG
CTTTCTTCGCTCTTCGCGATGACCTTCAGGCTAACTT
GTACGTACTGTGCAGCGTTGGATATAGCTTTATTCACGATGTTATTTCCATAGGTTCGATAACCAATGCGGTGAAGATGCTCA
CGAATCCCTTCGTCTGACTTTCC
GTAAGTACCAATGAAGTCAGATGTAGGCGGCCTTTTCTCATTCTTGAGTTTCTAGACGATGCCATCGCCTTCTCGCCTTCCCTCAAACAACAAGGAA
AGCCTGCTGGTGGAGGTGCAGACGGTTCCATGCTCATTTTCCCGGATGTTGAGCCCAACTTCCACGCCAACAACGGTATCTCCGACTCCGTCGATGCTCTTACACCCTTCTTGGCTGCAC
ACAACACCATCAGTGCTGGTGACCTCATCCAATTCGCAGGTGCTGTTGCAATCACTAACTGTCCTGGCGCTCCTCGTCTGCAATTCATGGCTGGTCGTCCTAACGCGACTGCCCCTGCTC
CCGACGGTCTCATCCCCGAGCCCCAAGATACCATTACCTCGATTCTCGCTCGTATGGAGGACGGTGGTGGATTCACTCCTGATGAAGTCGTTGCCTTGCTTGCGTCCCACTCTATCGCCC
GTGCAGACCATGTCGACCCGACATTGAACGCTGCTCCATTCGATAGCACTCCATTCGACTTTGACACCCAGATCTTCGTTGAAGTCTTGCTCAGGGGTGTTGGATTCCCCGGAACCGGAG
GCAACCAGG
GTAAGTGCCTCCCATGATAAAATTATAAACAAATATGGTGTTAATAATGCATATAGGTGAAGCGGAGTCTCCCTTGCCGAGGACCGATGAAGAAGATGTCGGCGAACTTCG
ACTCCTATCTGATCAGACATTTGCTCGTG
GTATGTCGATATTTCATACATGCAATAATTTCCACATCTAATATTTTATCAACAGACTCGAGGACTGCATGCACCTGGCAAGGGTTCGTGA
ACCAGCAAGCGAAGATGGCCAGCGCCTTCGGCGCTGCTATGGCCAAACTTGCTGTTATCGGCCAGGACACGTCCAAGATGATTGATTGCTCCGAAGTCGTTCCTATCCCTAAGCCTGCCA
CTGGCAAACCCGCGAC
GTCAGTCTCATTCCAGTTAAACATGAAGTAAATTGACTAATCTTTCCAACGTAGTTTCCCTGCTACTAAGACCAATGCGGATATTGAGCAAGCTTGCGCTTCCT
CTCCCTTCCCGCATCTCGCCACCGACCCAGGTCCAGTTGAGAGTTTGATCCC
GTGAGTAGTAATTAATTATGAAACTCAATTATTATTGACATAATATGGTTTTCCAGCCATTGCCCTGA
CGGTTCAGAGGACGACTGCGACGACAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGCTTTGCATCTCTCATCGTGTTCATTGGCATCTCTGTTGCAGCTGTTCAAGCAGCAAACTTCAGGCGTATTACCTGCCCCGATGGCGTTAACACTGCCACCAACGCTGCCTGCTGTG
CTTTCTTCGCTCTTCGCGATGACCTTCAGGCTAACTT
GTTCGATAACCAATGCGGTGAAGATGCTCACGAATCCCTTCGTCTGACTTTCCACGATGCCATCGCCTTCTCGCCTTCCCTCA
AACAACAAGGAAAGCCTGCTGGTGGAGGTGCAGACGGTTCCATGCTCATTTTCCCGGATGTTGAGCCCAACTTCCACGCCAACAACGGTATCTCCGACTCCGTCGATGCTCTTACACCCT
TCTTGGCTGCACACAACACCATCAGTGCTGGTGACCTCATCCAATTCGCAGGTGCTGTTGCAATCACTAACTGTCCTGGCGCTCCTCGTCTGCAATTCATGGCTGGTCGTCCTAACGCGA
CTGCCCCTGCTCCCGACGGTCTCATCCCCGAGCCCCAAGATACCATTACCTCGATTCTCGCTCGTATGGAGGACGGTGGTGGATTCACTCCTGATGAAGTCGTTGCCTTGCTTGCGTCCC
ACTCTATCGCCCGTGCAGACCATGTCGACCCGACATTGAACGCTGCTCCATTCGATAGCACTCCATTCGACTTTGACACCCAGATCTTCGTTGAAGTCTTGCTCAGGGGTGTTGGATTCC
CCGGAACCGGAGGCAACCAGG
GTGAAGCGGAGTCTCCCTTGCCGAGGACCGATGAAGAAGATGTCGGCGAACTTCGACTCCTATCTGATCAGACATTTGCTCGTGACTCGAGGACTGCAT
GCACCTGGCAAGGGTTCGTGAACCAGCAAGCGAAGATGGCCAGCGCCTTCGGCGCTGCTATGGCCAAACTTGCTGTTATCGGCCAGGACACGTCCAAGATGATTGATTGCTCCGAAGTCG
TTCCTATCCCTAAGCCTGCCACTGGCAAACCCGCGAC
TTTCCCTGCTACTAAGACCAATGCGGATATTGAGCAAGCTTGCGCTTCCTCTCCCTTCCCGCATCTCGCCACCGACCCAGGTC
CAGTTGAGAGTTTGATCCC
CCATTGCCCTGACGGTTCAGAGGACGACTGCGACGACAGCTGA

Retrieve as FASTA