Entry information : SsteMnP06
Entry ID 12320
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2017-04-20 (Catherine Mathe (Scipio))
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP06
Name SsteMnP06
Class Manganese peroxidase     [Orthogroup: MnP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP06
start..stop
S start..stop
SsteMnP08 319 1e-113 1..160 1..160
RrubMnP01 291 7e-100 1..185 1..186
RrubMnP03 284 6e-97 1..185 1..186
SsteMnP07 276 1e-96 1..174 1..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 88040..88191 152 N° 2 88242..88294 53 N° 3 88348..88697 350  
join(88040..88191,88242..88294,88348..88697)


exon

Literature and cross-references SsteMnP06
DNA ref. JGI genome:   scaffold_373 (88040..88697)
Cluster/Prediction ref. JGI gene:   91822
Protein sequence: SsteMnP06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   185 (167)
PWM (Da):   %s   19114.55 (17198.5)  
PI (pH):   %s   4.55 (4.43) Peptide Signal:   %s   cut: 19 range:19-185
Sequence 226
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLFAFVSLISFAAAAPPRLVACGDGNFASNSACCPLFGLREDLQANLFDNECGEDTHEVVRLTFHDAVAFSTSLKRQGKAAGGGADGSMLIFPTVEPNFSANNGIIDSVDALTPFLASHPKISAGDLIQFAGAVGISNCPGAPRLQFLLGRPNATAPAPDGLIPEPSDDVTKILARFSDAG

Retrieve as FASTA  
Remarks incorrect prediction from genomics (2 introns). 3' end missing
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCAAAACTCTTTTCGCCTTCGTTTCTTTGATCTCCTTTGCTGCAGCTGCCCCGCCAAGGCTTGTGGCTTGCGGCGACGGAAACTTTGCCAGTAACTCTGCCTGCTGCCCATTGT
TCGGTCTTAGGGAAGATCTTCAAGCAAACCT
GTAAGTTCCTGGATATTTTCTGTATCTTCTGATTTTAACTGACTGAATAGGTTCGACAATGAGTGTGGAGAAGACACTCATGAAGTTGT
TCGCTTGACTTTCC
GTAAGGATGCATTTCCGAGTTGTTTAATTGCAACTTATCTCATGTATCATTAGACGATGCTGTCGCTTTCTCCACTTCCTTGAAACGTCAGGGAAAGGCCGCCGGT
GGAGGTGCTGACGGTTCCATGCTCATCTTCCCGACTGTCGAGCCCAACTTCTCTGCCAACAATGGTATTATTGATAGTGTCGACGCCCTTACGCCATTCCTTGCTAGCCACCCAAAGATT
AGTGCAGGCGATTTGATTCAATTTGCCGGCGCTGTCGGTATCTCAAACTGCCCCGGTGCCCCGCGTCTTCAATTCCTCTTAGGTCGTCCCAACGCAACAGCTCCCGCTCCAGACGGTTTG
ATTCCTGAGCCATCAGATGACGTCACAAAAATTCTGGCACGCTTTAGCGACGCTGGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCAAAACTCTTTTCGCCTTCGTTTCTTTGATCTCCTTTGCTGCAGCTGCCCCGCCAAGGCTTGTGGCTTGCGGCGACGGAAACTTTGCCAGTAACTCTGCCTGCTGCCCATTGT
TCGGTCTTAGGGAAGATCTTCAAGCAAACCT
GTTCGACAATGAGTGTGGAGAAGACACTCATGAAGTTGTTCGCTTGACTTTCCACGATGCTGTCGCTTTCTCCACTTCCTTGAAACGTC
AGGGAAAGGCCGCCGGTGGAGGTGCTGACGGTTCCATGCTCATCTTCCCGACTGTCGAGCCCAACTTCTCTGCCAACAATGGTATTATTGATAGTGTCGACGCCCTTACGCCATTCCTTG
CTAGCCACCCAAAGATTAGTGCAGGCGATTTGATTCAATTTGCCGGCGCTGTCGGTATCTCAAACTGCCCCGGTGCCCCGCGTCTTCAATTCCTCTTAGGTCGTCCCAACGCAACAGCTC
CCGCTCCAGACGGTTTGATTCCTGAGCCATCAGATGACGTCACAAAAATTCTGGCACGCTTTAGCGACGCTGGA

Retrieve as FASTA