Entry information : SsteMnP07
Entry ID 12321
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2017-04-20 (Catherine Mathe (Scipio))
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP07
Name SsteMnP07
Class Manganese peroxidase     [Orthogroup: MnP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP07
start..stop
S start..stop
SsteMnP20 272 2e-92 1..172 1..174
SsteMnP03 272 3e-92 1..172 1..174
RrubMnP13 271 4e-92 1..172 1..175
SsteMnP15 270 2e-91 1..172 1..174
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 371..569 199 N° 2 4..320 317  
complement(join(4..320,371..569))


exon

Literature and cross-references SsteMnP07
DNA ref. JGI genome:   scaffold_876 (569..4)
Cluster/Prediction ref. JGI gene:   137912
Protein sequence: SsteMnP07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172 (154)
PWM (Da):   %s   17794.95 (15799.8)  
PI (pH):   %s   4.67 (4.39) Peptide Signal:   %s   cut: 19 range:19-172
Sequence 213
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTFISFLSILAVVRAAPFVTCPDGNRASNKACCPLFALRDDLQANLFDGVCGEDTHEILRLSFHDAIAFSPSLKRQGKPAGGGADGSMLIFPDVEPNFAANNGISDSVDALTPFLASHPEVTAGDLIQFAAAVGITNCPGAPRLRVLVGRPNATAPAPDGLIPEPSDSV

Retrieve as FASTA  
Remarks incorrect sequence from genomics(1 intron) missing 3' end.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGACCTTCATTTCATTCCTGTCCATCCTCGCAGTCGTCCGCGCCGCTCCCTTTGTCACCTGTCCCGATGGTAACAGGGCTAGCAACAAAGCTTGCTGCCCCTTGTTCGCG
CTTCGTGACGACCTCCAAGCCAACTTGTTCGATGGTGTATGCGGTGAAGACACTCACGAAATTCTTCGTCTGTCCTTCC
GTAAGTAATTTGATCTTTTGAAATGTATATTGTTAATTTGT
ATGATATAGACGATGCTATTGCCTTCTCTCCCTCTTTGAAAAGGCAAGGCAAACCCGCCGGTGGAGGTGCTGATGGTTCCATGCTCATTTTCCCTGATGTTGAACCCAACTTCGCTGCCA
ACAACGGTATCAGCGACAGTGTGGACGCACTTACTCCCTTCCTTGCGTCGCATCCTGAGGTTACTGCCGGCGATTTGATTCAATTTGCGGCTGCCGTTGGTATCACCAACTGCCCAGGTG
CCCCCAGGCTCCGAGTGCTTGTCGGTCGTCCTAATGCAACTGCTCCCGCTCCCGATGGTTTAATTCCTGAGCCGTCCGATTCAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGACCTTCATTTCATTCCTGTCCATCCTCGCAGTCGTCCGCGCCGCTCCCTTTGTCACCTGTCCCGATGGTAACAGGGCTAGCAACAAAGCTTGCTGCCCCTTGTTCGCG
CTTCGTGACGACCTCCAAGCCAACTTGTTCGATGGTGTATGCGGTGAAGACACTCACGAAATTCTTCGTCTGTCCTTCC
ACGATGCTATTGCCTTCTCTCCCTCTTTGAAAAGGCAAGGC
AAACCCGCCGGTGGAGGTGCTGATGGTTCCATGCTCATTTTCCCTGATGTTGAACCCAACTTCGCTGCCAACAACGGTATCAGCGACAGTGTGGACGCACTTACTCCCTTCCTTGCGTCG
CATCCTGAGGTTACTGCCGGCGATTTGATTCAATTTGCGGCTGCCGTTGGTATCACCAACTGCCCAGGTGCCCCCAGGCTCCGAGTGCTTGTCGGTCGTCCTAATGCAACTGCTCCCGCT
CCCGATGGTTTAATTCCTGAGCCGTCCGATTCAGT

Retrieve as FASTA