Entry information : SsteMnP09
Entry ID 12323
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2015-06-29 (Christophe Dunand)
Sequence status partial
Reviewer Catherine Mathe
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP09
Name SsteMnP09
Class Manganese peroxidase     [Orthogroup: MnP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP09
start..stop
S start..stop
RrubMnP13 410 6e-143 1..373 1..360
SsteMnP0410-1 404 2e-142 29..352 1..266
RrubMnP01 402 3e-140 1..373 1..359
SsteMnP03 400 2e-139 1..372 1..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1031827..1032028 202 N° 2 1031243..1031677 435 N° 3 1031143..1031187 45 N° 4 1030748..1031088 341
complement(join(1030748..1031088,1031143..1031187,1031243..1031677,1031827..1032 028))


exon

Literature and cross-references SsteMnP09
DNA ref. JGI genome:   scaffold_4 (1032028..1030748)
Cluster/Prediction ref. JGI gene:   240798
Protein sequence: SsteMnP09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   388 (367)
PWM (Da):   %s   40608.45 (38376.2) Transmb domain:   %s   i5-24o
PI (pH):   %s   4.7 (4.61) Peptide Signal:   %s   cut: 22 range:22-388
Sequence 430
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLLISFLSLLAVVGAALAVITCPDGNKARNAACCPLLAIRGDLQANLFDNQCGEDAHEALRLAFxDAIAFSSSLKKQGNPSGGGADGSMLIFPDVEPNFMLIFPDVEPNFPPNNGISDGISDIVESLTPFVADHPGITAGDLIQFSAAVGITNCPGAPRLQVLIGHPNATALTPQGLIPEPTDSVTTILARFTAAGNITASELVALLASHSTGRSDHVDATISSVPFDSTPFIFDTQFYLEVLLKGTRFPGTANNAGELSSPLPLGSGLNVVSPYTTPLDCDADPSVSVCTWQGFVNNQKSMASAFAAAMAKLSVLGQNTATFIDCSEVVPASLPQTKGAFFPATKSSRSSALLRQCLPQPSYRVRKYPGDHSVYFSCLLLIFFC*

Retrieve as FASTA  
Remarks Partial sequence from genomics (3 introns). Incorrect prediction from JGI (Distal H and short fragment after are missing due to frame shift).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAACTCCTCATTTCTTTCTTGTCCCTCCTTGCAGTCGTTGGTGCTGCCCTCGCTGTTATTACTTGCCCCGACGGTAACAAGGCTAGAAATGCAGCTTGCTGTCCCTTGCTC
GCTATTCGTGGCGACCTCCAAGCCAACCTGTTCGATAATCAATGCGGTGAAGACGCTCACGAAGCTCTTCGCCTCGCATTTC
GTAAGTAATTTGACTTTTCAAGGCATCCCGTGCTAATT
TGAATGCTTCAAACGATGCCATTGCTTTCTCTTCCTCATTGAAGAAGCAAGGGAACCCCTCTGGCGGAGGTGCTGATGGCTCATAGTATGCTCATTTTCCCCGATGTCGAGCCCAACTTC
CCCCAAACAACGGTATCTCTGACATTGTGGAATCTCTTACGCCCTTCGTTGCGGATCATCCTGGGATCACCGCTGGTGACTTGATCCAATTTTCGGCTGCTGTCGGTATCACCAACTGCC
CCGGTGCCCCCAGACTCCAAGTCCTCATTGGTCATCCCAACGCAACCGCTCTCACTCCCCAGGGGTTGATTCCTGAGCCTACTGATTCCGTTACTACAATTTTGGCGCGTTTCACCGCCG
CTGGTAATATCACGGCCTCCGAACTCGTTGCTTTGCTTGCGTCGCACTCGACCGGAAGGTCTGACCACGTTGACGCCACCATCTCAAGTGTTCCCTTTGATTCCACCCCGTTCATATTCG
ATACCCAGTTCTACTTGGAGGTCTTGCTCAAGGGTACCAGATTCCCCGGAACTGCCAACAACGCCG
GTACGTATAATACAATAATATGATCCACGTAGTCTATGCTTACATGGTGCTGTA
GGCGAACTCTCTTCCCCCTTGCCTCTCGGTAGCGGTTTGAACGTTGGTGAAATGCGTCTGCAATCCGACTTTGCTCTTGCTCATGATTCTCGCACATAAGTATCCCCTTACACCACGCCA
CTTGATTGCGATGCCGATCCCTCTGTCAGTGTCTGCACCTGGCAAGGATTTGTCAATAATCAGAAAAGTATGGCCAGCGCCTTTGCCGCTGCTATGGCTAAGCTCTCCGTCCTTGGGCAA
AACACGGCGACGTTCATCGACTGCTCTGAAGTCGTCCCCGCTAGTTTGCCCCAAACCAAGGGAGCCTTCTTCCCTGCCACAAAGAGCAGTCGATCTTCAGCTCTCTTGCGCCAATGCCTT
CCCCAACCTTCCTACCGCGTCCGGAAATACCCAGGTGATCATTCCGTATATTTTTCGTGCCTTCTCCTGATATTCTTCTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAACTCCTCATTTCTTTCTTGTCCCTCCTTGCAGTCGTTGGTGCTGCCCTCGCTGTTATTACTTGCCCCGACGGTAACAAGGCTAGAAATGCAGCTTGCTGTCCCTTGCTC
GCTATTCGTGGCGACCTCCAAGCCAACCTGTTCGATAATCAATGCGGTGAAGACGCTCACGAAGCTCTTCGCCTCGCATTTC
CCCAACTTCCCCCAAACAACGGTATCTCTGACATTGTG
GAATCTCTTACGCCCTTCGTTGCGGATCATCCTGGGATCACCGCTGGTGACTTGATCCAATTTTCGGCTGCTGTCGGTATCACCAACTGCCCCGGTGCCCCCAGACTCCAAGTCCTCATT
GGTCATCCCAACGCAACCGCTCTCACTCCCCAGGGGTTGATTCCTGAGCCTACTGATTCCGTTACTACAATTTTGGCGCGTTTCACCGCCGCTGGTAATATCACGGCCTCCGAACTCGTT
GCTTTGCTTGCGTCGCACTCGACCGGAAGGTCTGACCACGTTGACGCCACCATCTCAAGTGTTCCCTTTGATTCCACCCCGTTCATATTCGATACCCAGTTCTACTTGGAGGTCTTGCTC
AAGGGTACCAGATTCCCCGGAACTGCCAACAACGCCG
GCGAACTCTCTTCCCCCTTGCCTCTCGGTAGCGGTTTGAACGTTGTATCCCCTTACACCACGCCACTTGATTGCGATGCCGAT
CCCTCTGTCAGTGTCTGCACCTGGCAAGGATTTGTCAATAATCAGAAAAGTATGGCCAGCGCCTTTGCCGCTGCTATGGCTAAGCTCTCCGTCCTTGGGCAAAACACGGCGACGTTCATC
GACTGCTCTGAAGTCGTCCCCGCTAGTTTGCCCCAAACCAAGGGAGCCTTCTTCCCTGCCACAAAGAGCAGTCGATCTTCAGCTCTCTTGCGCCAATGCCTTCCCCAACCTTCCTACCGC
GTCCGGAAATACCCAGGTGATCATTCCGTATATTTTTCGTGCCTTCTCCTGATATTCTTCTG

Retrieve as FASTA