Entry information : SsteMnP11
Entry ID 12327
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP11
Name SsteMnP11
Class Manganese peroxidase    [Orthogroup: MnP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP11
start..stop
S start..stop
SsteMnP03 615 0 1..377 1..376
SsteMnP20 601 0 1..377 1..376
SsteMnP15 593 0 1..377 1..376
RrubMnP07 579 0 1..377 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2544649..2544809 161 N° 2 2544868..2544920 53 N° 3 2544982..2545509 528 N° 4 2545569..2545821 253
N° 5 2545881..2545982 102 N° 6 2546031..2546064 34  
join(2544649..2544809,2544868..2544920,2544982..2545509,2545569..2545821,2545881 ..2545982,2546031..2546064)


exon

Literature and cross-references SsteMnP11
DNA ref. JGI genome:   scaffold_2 (2544649..2546064)
Cluster/Prediction ref. JGI gene:   23658
Protein sequence: SsteMnP11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377 (300)
PWM (Da):   %s   39550.79 (33274.9)  
PI (pH):   %s   4.78 (10.36) Peptide Signal:   %s   cut: 25 range:25-324
Sequence 419
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKSLAIFVAIATFVQAAPSPSANLVRCADGNLATNAACCPFFALRDDLQTNLFENQCAEDAHEVVRLTFHDAISFSTSLKSQGKSAGGGADGSMIVFPDVEPNFPANNGISDSVDALTPFLATHAVTAGDLIQFAGAVALTNCPGAPRLQFLAGRPNATAPAPIGLIPEPQDAVEKIFARFADGGGFTPPEIIALLASHTIARADHVDATLDAAPFDSTPFDFDTQVFLEVLLKGTGFPGTGNNSGEVMSPLPLGSGKNVGELRLQSDFALARHPATACTWQSFINEQELMSASFKAAMAKLAVVGQDTRRMIDCSEVVPLPKPATRKASFPATKTRKDVQQACLFLPFPNLPTDAGPVQTFIPHCPAGEATCVT*

Retrieve as FASTA  
Remarks complete sequence from genomics (5 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCAAGTCCCTTGCAATCTTTGTCGCTATCGCCACTTTTGTTCAAGCGGCTCCATCTCCATCTGCTAACCTCGTCAGATGTGCAGATGGTAATTTAGCTACCAATGCTGCGTGTT
GCCCGTTCTTCGCTTTACGCGATGATCTTCAGACAAACCT
GTACGTTGAGCAGATATTTTTTCTTTGTGGAATATTTGACATTGACTTTGAAATTTAGTTTCGAGAACCAGTGCGCTGAG
GACGCTCATGAAGTAGTCCGCTTGACGTTCC
GTACGTGCTTTTTGTCTTTCCAGACGATTTATTTCGCTGATCTCTCTTATCTGTGTGTTAGATGACGCCATCTCTTTCTCTACTTCCCT
CAAGTCCCAAGGAAAGAGTGCCGGAGGCGGCGCTGACGGCTCGATGATCGTCTTCCCAGACGTCGAGCCCAACTTCCCAGCCAACAATGGAATTTCCGACAGTGTCGACGCTCTGACGCC
CTTCCTCGCCACACACGCTGTTACTGCCGGCGATCTCATCCAGTTCGCAGGAGCCGTTGCCCTCACCAATTGTCCCGGAGCTCCAAGATTGCAGTTCCTTGCCGGTCGCCCCAATGCTAC
TGCACCTGCCCCAATTGGCCTCATTCCTGAGCCGCAAGACGCCGTTGAGAAGATTTTTGCACGGTTTGCGGATGGTGGAGGATTCACTCCTCCCGAAATCATCGCTCTCTTGGCTTCGCA
CACGATTGCTCGTGCTGATCATGTCGACGCCACTCTTGATGCGGCTCCCTTCGACTCGACTCCCTTCGACTTCGACACCCAGGTTTTCCTTGAAGTCTTGCTTAAGGGCACTGGCTTCCC
CGGAACCGGTAACAACTCTG
GTAAGGGTCAAATTCAGATTGATATGAGATACATTGCTCAGCCTTTCCTTTGAATTCAGGCGAAGTCATGTCTCCATTGCCATTGGGCTCCGGCAAGAAC
GTCGGTGAACTTCGTCTTCAATCCGACTTCGCCCTCGCTCGTCACCCCGCCACGGCTTGCACCTGGCAAAGCTTCATCAACGAACAGGAATTGATGTCCGCTTCATTCAAAGCGGCCATG
GCGAAACTTGCTGTTGTTGGTCAAGACACTAGACGCATGATAGACTGCTCTGAAGTCGTCCCTCTTCCTAAGCCAGCAACCAGGAAAGCTTC
GTGAGTCTATACTATTTATTATTATTAT
TATTGAGGAGATTATTGAATATCTGTCTTAGCTTCCCGGCCACCAAGACAAGGAAGGATGTCCAACAAGCCTGCCTCTTCTTGCCCTTCCCCAACCTCCCAACCGACGCTGGTCCAGTTC
AAACCTTTATTCC
GTATGTTTATTTCATTGCTTTATTCGATTTTGTACTGACGAAAATTAGCCATTGCCCTGCTGGAGAGGCTACCTGTGTCACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCAAGTCCCTTGCAATCTTTGTCGCTATCGCCACTTTTGTTCAAGCGGCTCCATCTCCATCTGCTAACCTCGTCAGATGTGCAGATGGTAATTTAGCTACCAATGCTGCGTGTT
GCCCGTTCTTCGCTTTACGCGATGATCTTCAGACAAACCT
TTTCGAGAACCAGTGCGCTGAGGACGCTCATGAAGTAGTCCGCTTGACGTTCCATGACGCCATCTCTTTCTCTACTTCCC
TCAAGTCCCAAGGAAAGAGTGCCGGAGGCGGCGCTGACGGCTCGATGATCGTCTTCCCAGACGTCGAGCCCAACTTCCCAGCCAACAATGGAATTTCCGACAGTGTCGACGCTCTGACGC
CCTTCCTCGCCACACACGCTGTTACTGCCGGCGATCTCATCCAGTTCGCAGGAGCCGTTGCCCTCACCAATTGTCCCGGAGCTCCAAGATTGCAGTTCCTTGCCGGTCGCCCCAATGCTA
CTGCACCTGCCCCAATTGGCCTCATTCCTGAGCCGCAAGACGCCGTTGAGAAGATTTTTGCACGGTTTGCGGATGGTGGAGGATTCACTCCTCCCGAAATCATCGCTCTCTTGGCTTCGC
ACACGATTGCTCGTGCTGATCATGTCGACGCCACTCTTGATGCGGCTCCCTTCGACTCGACTCCCTTCGACTTCGACACCCAGGTTTTCCTTGAAGTCTTGCTTAAGGGCACTGGCTTCC
CCGGAACCGGTAACAACTCTG
GCGAAGTCATGTCTCCATTGCCATTGGGCTCCGGCAAGAACGTCGGTGAACTTCGTCTTCAATCCGACTTCGCCCTCGCTCGTCACCCCGCCACGGCTT
GCACCTGGCAAAGCTTCATCAACGAACAGGAATTGATGTCCGCTTCATTCAAAGCGGCCATGGCGAAACTTGCTGTTGTTGGTCAAGACACTAGACGCATGATAGACTGCTCTGAAGTCG
TCCCTCTTCCTAAGCCAGCAACCAGGAAAGCTTC
CTTCCCGGCCACCAAGACAAGGAAGGATGTCCAACAAGCCTGCCTCTTCTTGCCCTTCCCCAACCTCCCAACCGACGCTGGTCCAG
TTCAAACCTTTATTCC
CCATTGCCCTGCTGGAGAGGCTACCTGTGTCACT

Retrieve as FASTA