Entry information : SsteCcP01
Entry ID 12328
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteCcP01
Name SsteCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteCcP01
start..stop
S start..stop
GmorcCcP01 556 0 1..372 1..371
RrubCcP01 546 0 1..372 1..385
SnivCcP01 531 0 8..370 5..366
HpinCcP 528 0 3..363 2..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 751343..751636 294 N° 2 751686..751813 128 N° 3 751866..752019 154 N° 4 752073..752189 117
N° 5 752249..752265 17 N° 6 752324..752467 144 N° 7 752518..752589 72 N° 8 752644..752727 84
N° 9 752786..752891 106  
join(751343..751636,751686..751813,751866..752019,752073..752189,752249..752265, 752324..752467,752518..752589,752644..752727,752786..752891)


exon

Literature and cross-references SsteCcP01
DNA ref. JGI genome:   scaffold_18 (751343..752891)
Cluster/Prediction ref. JGI gene:   27873
Protein sequence: SsteCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   41292.72  
PI (pH):   %s   9.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLLRTRVPIPRAVLRSRTNFRLPTPRKYSTQTGGEAPKSAPKSNTGLYLGIAGALALAGGAYYVLSPGKAETAAKTAIQSAKAATHFTPTKEDYQKVYNTIASMLDADDYDDGSYGPVLVRLAWHSSGTYDKNDNTGGSNYATMRFSPEALHGANNGLNVARDLMEKVKQQYPWISYGDLWTLAGVVAIQEMAGPKVPWRAGRIDGYEKDVTPDGRLPDAAQGQDHLRNIFYRMGFNDQEIVALSGAHALGRCHKDRSGFDGPWTFSPTTFTNDFYTLLLNEKWVWRKWNGPKQLADKKTGSLMMLPTDYVLTQDKSFKKWVQAYAADEQAFFNDFSKTFAKLLELGVPASQWVASEPWIMQTVDEQQSK*

Retrieve as FASTA  
Remarks complete sequence from genomics (8 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTCTTCTCCGTACCCGTGTCCCTATTCCCCGCGCTGTCCTCCGCTCCAGGACCAACTTCAGGCTCCCTACTCCCCGCAAGTACTCTACTCAGACCGGAGGCGAGGCACCCAAG
TCGGCACCCAAGTCTAACACCGGTCTTTACCTCGGCATTGCTGGTGCTCTCGCTCTCGCTGGCGGAGCGTACTATGTTCTCTCTCCAGGGAAGGCTGAGACCGCCGCAAAGACGGCCATC
CAGTCTGCAAAGGCGGCTACTCACTTTACCCCGACGAAGGAGGACTACCAGAAG
GTACGCGGCATCATCATATTGGTGGATATGGCGCTGACACGTTGATAAGGTCTATAACACCATTGC
CTCCATGCTGGATGCGGACGATTACGACGATGGCTCATATGGCCCCGTCCTAGTCCGTCTTGCATGGCACTCGTCCGGAACCTATGATAAGAACGATAACACTGGTGGAAG
GTACGCCTC
ATCCCTAGTGGCCCTATCAGTTCCCTAAATGCTGTGTTTACAGCAACTACGCTACTATGCGTTTCTCCCCAGAGGCCCTCCACGGTGCCAACAACGGTCTTAATGTCGCCCGGGACTTGA
TGGAAAAGGTCAAGCAGCAATACCCCTGGATCAGCTACGGTGATCTCTGGACATTGGCTGGTGTCGTCGCCATCCAG
GTAAGCTCTGCGAGCTCTATATATGCGCTCCTATTCAGACGGC
CCTCGCTTAGGAAATGGCTGGGCCTAAAGTTCCATGGAGAGCCGGACGTATTGATGGCTACGAAAAGGACGTGACTCCCGACGGCCGTCTTCCCGATGCTGCACAAGGACAGGACCACCT
CCGCAAT
GTAAGTAGTACCGCTCGTTTCAGTTATATTGCGCTGGGACTGATGGATGATTTGGGCAGATTTTCTACCGCATGGGGTATGCTTCATCATAATGGCGATACGTCTGTATCTTT
CTAACCTAATTCCATATGTAGCTTCAACGACCAGGAAATCGTCGCTCTCTCTGGTGCTCACGCTCTCGGACGCTGCCACAAGGACCGCTCTGGATTTGACGGCCCATGGACTTTCTCCCC
CACCACCTTCACCAACGACTTCTACACCCTCCTCCTCAACGAGAA
GTGCGTTTCATTCATTATACTCATTAATAATAATCTCTGACATTTAATAGGTGGGTCTGGCGCAAGTGGAACGGC
CCCAAGCAACTTGCAGACAAGAAAACCGGCTCGCTTATGATGCTGCC
GTACGTATTCTATTCATATAATCATGATTTCACGACCCTGAGCTCTCCAAATAGTACCGACTACGTTCTCACC
CAAGACAAGTCCTTCAAGAAGTGGGTGCAGGCGTACGCCGCTGACGAACAGGCCTTCTTCAACGA
GTAAGTCCCTCGCCATCATCGTCCCGGCGTAACGTATTCTAAGACGAACGTCCTA
CAGCTTCTCCAAGACCTTTGCCAAGCTGCTCGAACTCGGCGTGCCCGCTTCTCAATGGGTCGCCTCCGAGCCATGGATCATGCAGACTGTCGACGAGCAACAATCCAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTCTTCTCCGTACCCGTGTCCCTATTCCCCGCGCTGTCCTCCGCTCCAGGACCAACTTCAGGCTCCCTACTCCCCGCAAGTACTCTACTCAGACCGGAGGCGAGGCACCCAAG
TCGGCACCCAAGTCTAACACCGGTCTTTACCTCGGCATTGCTGGTGCTCTCGCTCTCGCTGGCGGAGCGTACTATGTTCTCTCTCCAGGGAAGGCTGAGACCGCCGCAAAGACGGCCATC
CAGTCTGCAAAGGCGGCTACTCACTTTACCCCGACGAAGGAGGACTACCAGAAG
GTCTATAACACCATTGCCTCCATGCTGGATGCGGACGATTACGACGATGGCTCATATGGCCCCGTC
CTAGTCCGTCTTGCATGGCACTCGTCCGGAACCTATGATAAGAACGATAACACTGGTGGAAG
CAACTACGCTACTATGCGTTTCTCCCCAGAGGCCCTCCACGGTGCCAACAACGGTCTT
AATGTCGCCCGGGACTTGATGGAAAAGGTCAAGCAGCAATACCCCTGGATCAGCTACGGTGATCTCTGGACATTGGCTGGTGTCGTCGCCATCCAG
GAAATGGCTGGGCCTAAAGTTCCA
TGGAGAGCCGGACGTATTGATGGCTACGAAAAGGACGTGACTCCCGACGGCCGTCTTCCCGATGCTGCACAAGGACAGGACCACCTCCGCAAT
ATTTTCTACCGCATGGGCTTCAACGAC
CAGGAAATCGTCGCTCTCTCTGGTGCTCACGCTCTCGGACGCTGCCACAAGGACCGCTCTGGATTTGACGGCCCATGGACTTTCTCCCCCACCACCTTCACCAACGACTTCTACACCCTC
CTCCTCAACGAGAA
GTGGGTCTGGCGCAAGTGGAACGGCCCCAAGCAACTTGCAGACAAGAAAACCGGCTCGCTTATGATGCTGCCTACCGACTACGTTCTCACCCAAGACAAGTCCTTC
AAGAAGTGGGTGCAGGCGTACGCCGCTGACGAACAGGCCTTCTTCAACGA
CTTCTCCAAGACCTTTGCCAAGCTGCTCGAACTCGGCGTGCCCGCTTCTCAATGGGTCGCCTCCGAGCCA
TGGATCATGCAGACTGTCGACGAGCAACAATCCAAG

Retrieve as FASTA