Entry information : SsteMnP12
Entry ID 12329
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP12
Name SsteMnP12
Class Manganese peroxidase    [Orthogroup: MnP004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP12
start..stop
S start..stop
SsteMnP13 684 0 1..378 1..378
SsteMnP22 671 0 1..373 1..373
SsteMnP18 657 0 1..373 1..374
SsteMnP05 634 0 1..378 1..381
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 199219..199394 176 N° 2 199450..199502 53 N° 3 199553..200083 531 N° 4 200140..200233 94
N° 5 200284..200448 165 N° 6 200508..200606 99 N° 7 200663..200678 16  
join(199219..199394,199450..199502,199553..200083,200140..200233,200284..200448, 200508..200606,200663..200678)


exon

Literature and cross-references SsteMnP12
DNA ref. JGI genome:   scaffold_124 (199219..200678)
Cluster/Prediction ref. JGI gene:   35096
Protein sequence: SsteMnP12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   379 (360)
PWM (Da):   %s   39514.94 (37609.9)  
PI (pH):   %s   4.68 (4.60) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKALAIFASLASLVVAVPQASPDAATTASVRCPDGNIAPHSACCPFFALRDDLLENLFQGVCGEDAHQAVRLIFHDSIAFSQSMERKGIFSGGGADGSVLVFPDVEANRAENAGISDGVQGQLPFLSRHPVTAADLVQFAAAVGITNCPGAPRLKFFTGRPNATAVPPEGLVPSPADDVTTILARFADASSAISPDDVVALLSSHSIANADHVDPDIQAVPFDSTQNTFDTQLFLEVLLKGIGFPGSANNSGEVSSPLPIGTAAQPGELRLQSDFAIARDPRTACTWQSFINNQELMQNAFVVAVDKMSRIGLKNPQNLVDCSVVVPQPVAKVTKPATYPATKSFKDIQQACPKRFPSLASDPGATETLVAGQVGT*

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAAGCATTAGCCATCTTCGCCTCCCTCGCCTCCCTCGTCGTCGCAGTACCCCAGGCTTCTCCGGACGCCGCGACCACAGCGAGCGTAAGATGCCCCGATGGCAATATAGCC
CCTCATTCAGCTTGCTGCCCTTTCTTCGCTTTGCGCGATGACTTACTGGAGAACTT
GTGCAACCTCATTTCCTGTTACGTTGTTCTAGCTCTAATTTATTCTGTTTTACAGGTTCCAAGG
TGTTTGTGGTGAAGACGCTCACCAGGCCGTCCGTCTTATTTTCC
GTACGTTCTTGAACGCATTTCAAGTGTTCATATTACTTATTCCGCTGCAGACGACTCGATTGCTTTCTCTCAATCG
ATGGAACGTAAAGGTATTTTCTCCGGTGGAGGAGCCGACGGTTCAGTGCTCGTCTTCCCTGATGTCGAGGCGAATCGTGCAGAAAATGCCGGTATCTCGGATGGTGTTCAAGGGCAACTT
CCCTTCTTGTCAAGGCATCCGGTTACCGCTGCCGATCTTGTCCAATTTGCCGCTGCCGTCGGTATCACCAACTGCCCTGGCGCACCCAGACTGAAGTTCTTCACTGGTCGTCCAAATGCC
ACGGCAGTTCCTCCCGAAGGACTCGTCCCCTCGCCCGCAGACGACGTCACTACGATTCTTGCACGTTTCGCAGATGCCTCCAGTGCCATTTCTCCCGACGACGTCGTCGCATTGTTGTCT
TCTCATAGTATTGCCAATGCCGATCACGTCGACCCGGATATCCAAGCTGTTCCTTTCGACAGCACTCAGAACACCTTCGACACTCAACTCTTCCTTGAGGTCTTGCTCAAGGGTATCGGC
TTCCCTGGAAGCGCTAACAACAGTG
GTAAGTTTGATTATTTAGATGTGTGCAGTGTCTAAACTCATCTTCTTGGTTTATAGGTGAAGTTTCATCTCCTCTTCCCATCGGCACCGCGGCTC
AGCCAGGTGAATTGCGTCTCCAATCCGACTTTGCTATCGCTCGGGACCCAAGAAC
GTTAGTGTCATCCATTTTGAAAAGTAATTTGATTCTGAACAATGTTGCAGCGCCTGTACCTGGCA
AAGTTTCATCAATAACCAAGAACTTATGCAAAATGCATTCGTTGTGGCCGTCGACAAGATGTCCAGAATTGGGTTGAAAAACCCCCAAAATCTCGTTGATTGCTCGGTAGTTGTTCCTCA
GCCGGTTGCCAAGGTCACGAAGCCTGCCAC
GTGAGTTCTTTTCAGTGTTTTCTGTCTCCTTCAAAGGGATATTCATGTTTTGTTTCTAGGTACCCTGCGACCAAGTCTTTCAAAGATATT
CAACAGGCTTGCCCGAAACGCTTCCCGAGTCTCGCTTCTGATCCAGGTGCCACTGAAACCCTCGTTGC
GTAAGTCTTTTATACGACTGTCGTTATTATAAATACTTACTCATTACTCCTT
TCAGCGGCCAGGTCGGTACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCAAAGCATTAGCCATCTTCGCCTCCCTCGCCTCCCTCGTCGTCGCAGTACCCCAGGCTTCTCCGGACGCCGCGACCACAGCGAGCGTAAGATGCCCCGATGGCAATATAGCC
CCTCATTCAGCTTGCTGCCCTTTCTTCGCTTTGCGCGATGACTTACTGGAGAACTT
GTTCCAAGGTGTTTGTGGTGAAGACGCTCACCAGGCCGTCCGTCTTATTTTCCACGACTCGATT
GCTTTCTCTCAATCGATGGAACGTAAAGGTATTTTCTCCGGTGGAGGAGCCGACGGTTCAGTGCTCGTCTTCCCTGATGTCGAGGCGAATCGTGCAGAAAATGCCGGTATCTCGGATGGT
GTTCAAGGGCAACTTCCCTTCTTGTCAAGGCATCCGGTTACCGCTGCCGATCTTGTCCAATTTGCCGCTGCCGTCGGTATCACCAACTGCCCTGGCGCACCCAGACTGAAGTTCTTCACT
GGTCGTCCAAATGCCACGGCAGTTCCTCCCGAAGGACTCGTCCCCTCGCCCGCAGACGACGTCACTACGATTCTTGCACGTTTCGCAGATGCCTCCAGTGCCATTTCTCCCGACGACGTC
GTCGCATTGTTGTCTTCTCATAGTATTGCCAATGCCGATCACGTCGACCCGGATATCCAAGCTGTTCCTTTCGACAGCACTCAGAACACCTTCGACACTCAACTCTTCCTTGAGGTCTTG
CTCAAGGGTATCGGCTTCCCTGGAAGCGCTAACAACAGTG
GTGAAGTTTCATCTCCTCTTCCCATCGGCACCGCGGCTCAGCCAGGTGAATTGCGTCTCCAATCCGACTTTGCTATCGCT
CGGGACCCAAGAAC
CGCCTGTACCTGGCAAAGTTTCATCAATAACCAAGAACTTATGCAAAATGCATTCGTTGTGGCCGTCGACAAGATGTCCAGAATTGGGTTGAAAAACCCCCAAAAT
CTCGTTGATTGCTCGGTAGTTGTTCCTCAGCCGGTTGCCAAGGTCACGAAGCCTGCCAC
GTACCCTGCGACCAAGTCTTTCAAAGATATTCAACAGGCTTGCCCGAAACGCTTCCCGAGT
CTCGCTTCTGATCCAGGTGCCACTGAAACCCTCGTTGC
CGGCCAGGTCGGTACT

Retrieve as FASTA