Entry information : SsteMnP13
Entry ID 12330
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2017-04-26 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-26 (Catherine Mathe)
Peroxidase information: SsteMnP13
Name SsteMnP13
Class Manganese peroxidase    [Orthogroup: MnP004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP13
start..stop
S start..stop
SsteMnP18 716 0 1..373 1..374
SsteMnP22 700 0 1..373 1..373
SsteMnP05 687 0 1..378 1..381
SsteMnP12 684 0 1..378 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129679..129854 176 N° 2 129910..129962 53 N° 3 130013..130540 528 N° 4 130597..130690 94
N° 5 130741..130905 165 N° 6 130965..131066 102 N° 7 131121..131139 19  
join(129679..129854,129910..129962,130013..130540,130597..130690,130741..130905, 130965..131066,131121..131139)


exon

Literature and cross-references SsteMnP13
DNA ref. JGI genome:   scaffold_336 (129679..131139)
Cluster/Prediction ref. JGI gene:   38647
Protein sequence: SsteMnP13
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39569.86 (37636.8)  
PI (pH):   %s   4.62 (4.55) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKALAIFASLVSLVVAVPQATPDSATTASIKCPDGNIAPHSACCPFFALRDDMLEHLFQGVCGEDAHQAVRLIFHDSIGFSQEMHAKGIFSGGGADGSVLVFPDVEANRAENAGISDGVQGQLPFLANHPVTAADLVQFAAAVGITNCPGSPRLKFFTGRPNATAPPPEGLVPNPADSVTKILARFDDAGNIQPAEVVALLASHSIANADHVDPDIQAVPFDSTQNTFDTQLFLEVLLKGIGFPGSANNSGEVSSPLPIGTTAQPGELRLQSDFALARDPRTACVWQSFINNQELMQNAFVEAVDKMSRIGLAHPENLIDCSVVVPQPVAKVTKPATYPATKSFKDIQRACFAAPFPSLASDPGATETLVAGQVGT*

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAGCATTAGCCATCTTCGCCTCCCTCGTCTCCCTCGTCGTCGCAGTACCTCAGGCTACTCCAGACTCCGCGACCACAGCGAGCATAAAATGCCCCGATGGCAATATAGCC
CCTCACTCCGCTTGCTGCCCTTTCTTCGCTTTGCGCGATGATATGCTGGAGCACTT
GTACGACCTACTTTCCTATTACGGTGGTCTTGCTCTAATTTATTCCTATTAATAGGTTCCAAGG
TGTTTGCGGTGAAGATGCTCACCAGGCCGTCCGTCTTATTTTCC
GTACGTCCCCGATCGCATTTGAAGTCTTTTTAGCACTTATTCCCTTGCAGACGACTCGATTGGTTTCTCCCAGGAG
ATGCACGCTAAAGGCATCTTCTCCGGTGGAGGAGCCGACGGTTCAGTGCTCGTCTTCCCCGATGTTGAGGCGAATCGTGCAGAAAATGCCGGTATCTCCGATGGTGTTCAAGGGCAACTT
CCCTTCTTGGCAAATCACCCTGTTACCGCTGCCGATCTTGTCCAATTCGCCGCTGCCGTCGGTATCACCAACTGCCCTGGTTCACCCAGGCTGAAATTCTTCACTGGTCGTCCAAATGCC
ACCGCACCTCCTCCTGAAGGTCTCGTCCCCAACCCCGCAGACTCGGTCACTAAGATTCTCGCACGTTTCGACGATGCCGGTAACATCCAGCCCGCCGAGGTCGTCGCATTACTGGCTTCT
CATAGTATCGCCAATGCCGATCACGTCGACCCAGATATCCAAGCTGTTCCTTTCGACAGCACTCAGAACACCTTCGACACTCAACTCTTCCTTGAGGTCTTGCTTAAGGGTATCGGCTTC
CCTGGATCCGCTAACAACAGTG
GTAAGTTTTATTATTTAGATGTGTGCAGTGTCTGAACTCATCTTTTTGGTTTATAGGCGAAGTCTCATCTCCTCTTCCCATCGGCACCACGGCTCAGC
CAGGTGAACTGCGTCTCCAATCTGACTTTGCTCTCGCTCGGGACCCACGAAC
GTAAGTGTCATCCATTTTGAAAATTAATTTGACTCTGAAAAATGTTGCAGCGCCTGTGTTTGGCAAAG
CTTCATCAACAACCAAGAACTGATGCAGAATGCCTTCGTTGAGGCCGTCGACAAGATGTCTAGAATTGGATTGGCACACCCCGAAAATCTTATTGATTGCTCGGTAGTTGTTCCCCAGCC
GGTTGCCAAGGTTACGAAGCCCGCCAC
GTGAGTTCTTTTCAGTGTTTTCTGTCTCTTTCAAATGAGTATTCATGTTTTGTTTCTAGATACCCCGCGACGAAATCTTTCAAAGATATTCAA
CGGGCTTGCTTCGCGGCTCCTTTCCCGAGTCTCGCTTCCGATCCAGGTGCCACTGAAACCCTCGTCGC
GTAAGTCTTTTATATGACTGGTCATTATAAGTATTTACTCGTTACCTCTTTC
AGCGGCCAGGTCGGTACTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAGCATTAGCCATCTTCGCCTCCCTCGTCTCCCTCGTCGTCGCAGTACCTCAGGCTACTCCAGACTCCGCGACCACAGCGAGCATAAAATGCCCCGATGGCAATATAGCC
CCTCACTCCGCTTGCTGCCCTTTCTTCGCTTTGCGCGATGATATGCTGGAGCACTT
GTTCCAAGGTGTTTGCGGTGAAGATGCTCACCAGGCCGTCCGTCTTATTTTCCACGACTCGATT
GGTTTCTCCCAGGAGATGCACGCTAAAGGCATCTTCTCCGGTGGAGGAGCCGACGGTTCAGTGCTCGTCTTCCCCGATGTTGAGGCGAATCGTGCAGAAAATGCCGGTATCTCCGATGGT
GTTCAAGGGCAACTTCCCTTCTTGGCAAATCACCCTGTTACCGCTGCCGATCTTGTCCAATTCGCCGCTGCCGTCGGTATCACCAACTGCCCTGGTTCACCCAGGCTGAAATTCTTCACT
GGTCGTCCAAATGCCACCGCACCTCCTCCTGAAGGTCTCGTCCCCAACCCCGCAGACTCGGTCACTAAGATTCTCGCACGTTTCGACGATGCCGGTAACATCCAGCCCGCCGAGGTCGTC
GCATTACTGGCTTCTCATAGTATCGCCAATGCCGATCACGTCGACCCAGATATCCAAGCTGTTCCTTTCGACAGCACTCAGAACACCTTCGACACTCAACTCTTCCTTGAGGTCTTGCTT
AAGGGTATCGGCTTCCCTGGATCCGCTAACAACAGTG
GCGAAGTCTCATCTCCTCTTCCCATCGGCACCACGGCTCAGCCAGGTGAACTGCGTCTCCAATCTGACTTTGCTCTCGCTCGG
GACCCACGAAC
CGCCTGTGTTTGGCAAAGCTTCATCAACAACCAAGAACTGATGCAGAATGCCTTCGTTGAGGCCGTCGACAAGATGTCTAGAATTGGATTGGCACACCCCGAAAATCTT
ATTGATTGCTCGGTAGTTGTTCCCCAGCCGGTTGCCAAGGTTACGAAGCCCGCCAC
ATACCCCGCGACGAAATCTTTCAAAGATATTCAACGGGCTTGCTTCGCGGCTCCTTTCCCGAGT
CTCGCTTCCGATCCAGGTGCCACTGAAACCCTCGTCGC
CGGCCAGGTCGGTACTTAG

Retrieve as FASTA