Entry information : SsteVP01
Entry ID 12331
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteVP01
Name SsteVP01
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteVP01
start..stop
S start..stop
SsteVP02 344 2e-118 22..308 10..298
PoVP04_PC9 264 6e-87 27..311 28..311
PoVP04_PC15 261 6e-86 27..311 28..311
PoVP06_PC9 253 2e-82 22..318 23..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19370..19433 64 N° 2 19195..19316 122 N° 3 18942..19138 197 N° 4 18764..18885 122
N° 5 18590..18710 121 N° 6 18445..18525 81 N° 7 18111..18393 283  
complement(join(18111..18393,18445..18525,18590..18710,18764..18885,18942..19138 ,19195..19316,19370..19433))


exon

Literature and cross-references SsteVP01
DNA ref. JGI genome:   scaffold_168 (19433..18111)
Cluster/Prediction ref. JGI gene:   61661
Protein sequence: SsteVP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   34778.64 (31906.9)  
PI (pH):   %s   6.13 (4.88) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVKLILQSLLVICFLKTIPHVAAAVTCPGGPIVQNARCCDLVPVLKDLQANLTAGDVCNGLARSTLRLAFHDAMGFSNTVNMGGGADGSVLTFHTIEMGYAANVRLDLLVSILQSFVGRHNISTGDFLHFAAAYALTTCPGAPGLSFFYGRPPPTVAAPDNTIPLASDPINHTLARFLDVGFTPPEVVALLAAHSIASSSLSNIFNIVPTMDSTPLVFDNQFFKEVLLPGNFPNNSVDPNQTVASPFSWEIRLKSDAAFAAAPQTSAVWQGFINSPSSLIPAFSQAMSKMSLIGYQSSNLVDCSDLVPIPSPAPSTSTTSGTNPPQPTL*

Retrieve as FASTA  
Remarks Complete sequence from genomics (6 introns). Conserved AA in 5' and 3' are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTCAAGCTTATTTTGCAAAGTCTCTTGGTTATCTGTTTCTTGAAAACGATTCCTCACGGTAAGTGGGTCTGAGCTGTTGTCATCGGTCACGCTGTTGACTTTGTAGTACAGTCG
CCGCCGCCGTAACGTGCCCCGGAGGACCTATTGTTCAAAACGCTAGATGTTGTGATTTAGTTCCAGTTTTGAAAGACTTGCAAGCAAATCTCACCGCCGGTGATGTCTGCAACGGACTG
G
TCAGTTGGCTCTCGGTATATATTGTAGCGGTAATAACTGAAGCTGCCTTTAACAGGCACGATCAACTCTCCGCCTAGCCTTTCACGATGCTATGGGTTTCTCAAACACCGTGAACATGGG
TGGTGGTGCCGATGGATCCGTCCTAACGTTCCACACTATCGAAATGGGATATGCAGCGAACGTGAGGTTGGACCTGCTCGTTTCGATTTTACAATCATTCGTAGGCAGACACAATATTTC
AACAGGTGATTT
GTGAGCCACAGAATTTTACTATGTTTACGGAGAGATACATTGCTAATACATTCTAGTCTTCACTTTGCTGCTGCCTATGCTCTTACCACTTGTCCGGGTGCCCCTGGT
CTTTCTTTCTTCTACGGCCGGCCGCCTCCAACGGTAGCAGCCCCTGATAACACCATTCCCTTGGCTAGTG
GTAGGAACCCGTGATTCAAACTTCGAATACCAACGCGACCTGACTTTGTT
TAGATCCGATTAATCATACTCTGGCTCGGTTTCTCGATGTGGGCTTCACTCCGCCTGAGGTAGTTGCTCTCCTAGCTGCACACTCTATTGCGTCCAGTAGCCTAAGTAATATTTTTAATA
TTGT
GTAAGTCATATATCCTAGCTGTACAAATGTTTTAAATTCTTTCACCTCATTTTCTCTTCTTTAGCCCAACCATGGACTCTACGCCACTGGTCTTCGATAATCAGTTCTTCAAAGAA
GTACTTCTCCCTGGTAATTTTCCCAACAA
GTATGTTTTATATTTTCATAACGAATTAGATTAACTTATTATCTTTCACAGCTCCGTCGACCCGAACCAAACGGTGGCGTCCCCTTTCTCG
TGGGAGATACGCCTTAAGTCGGACGCGGCGTTCGCTGCAGCCCCGCAAACATCAGCTGTATGGCAGGGGTTCATCAATAGCCCTTCATCTTTAATTCCTGCATTTAGTCAAGCTATGTCC
AAGATGTCCCTCATCGGTTATCAGTCCTCAAACCTAGTCGACTGTTCGGATCTTGTGCCCATTCCTTCACCAGCTCCCTCGACTAGTACAACATCGGGTACAAACCCCCCTCAACCTACT
TTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGTCAAGCTTATTTTGCAAAGTCTCTTGGTTATCTGTTTCTTGAAAACGATTCCTCACGTCGCCGCCGCCGTAACGTGCCCCGGAGGACCTATTGTTCAAAACGCTAGATGTTGT
GATTTAGTTCCAGTTTTGAAAGACTTGCAAGCAAATCTCACCGCCGGTGATGTCTGCAACGGACTG
GCACGATCAACTCTCCGCCTAGCCTTTCACGATGCTATGGGTTTCTCAAACACC
GTGAACATGGGTGGTGGTGCCGATGGATCCGTCCTAACGTTCCACACTATCGAAATGGGATATGCAGCGAACGTGAGGTTGGACCTGCTCGTTTCGATTTTACAATCATTCGTAGGCAGA
CACAATATTTCAACAGGTGATTT
TCTTCACTTTGCTGCTGCCTATGCTCTTACCACTTGTCCGGGTGCCCCTGGTCTTTCTTTCTTCTACGGCCGGCCGCCTCCAACGGTAGCAGCCCCT
GATAACACCATTCCCTTGGCTAGTG
ATCCGATTAATCATACTCTGGCTCGGTTTCTCGATGTGGGCTTCACTCCGCCTGAGGTAGTTGCTCTCCTAGCTGCACACTCTATTGCGTCCAGT
AGCCTAAGTAATATTTTTAATATTGT
CCCAACCATGGACTCTACGCCACTGGTCTTCGATAATCAGTTCTTCAAAGAAGTACTTCTCCCTGGTAATTTTCCCAACAACTCCGTCGACCCG
AACCAAACGGTGGCGTCCCCTTTCTCGTGGGAGATACGCCTTAAGTCGGACGCGGCGTTCGCTGCAGCCCCGCAAACATCAGCTGTATGGCAGGGGTTCATCAATAGCCCTTCATCTTTA
ATTCCTGCATTTAGTCAAGCTATGTCCAAGATGTCCCTCATCGGTTATCAGTCCTCAAACCTAGTCGACTGTTCGGATCTTGTGCCCATTCCTTCACCAGCTCCCTCGACTAGTACAACA
TCGGGTACAAACCCCCCTCAACCTACTTTG

Retrieve as FASTA