Entry information : SsteVP02
Entry ID 12332
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteVP02
Name SsteVP02
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteVP02
start..stop
S start..stop
SsteVP01 354 2e-122 10..315 22..325
PoVP04_PC9 272 5e-90 16..301 29..311
PoVP04_PC15 270 3e-89 16..301 29..311
PcriCIIBB05 268 4e-88 9..301 22..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 481631..481649 19 N° 2 481693..481823 131 N° 3 481889..482091 203 N° 4 482145..482266 122
N° 5 482318..482438 121 N° 6 482506..482586 81 N° 7 482641..482980 340  
join(481631..481649,481693..481823,481889..482091,482145..482266,482318..482438, 482506..482586,482641..482980)


exon

Literature and cross-references SsteVP02
DNA ref. JGI genome:   scaffold_72 (481631..482980)
Cluster/Prediction ref. JGI gene:   60629
Protein sequence: SsteVP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   35949.62  
PI (pH):   %s   3.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAIRQDIALADSFVCPQGQTVQNAECCALIPVLEDLQTNYFAGEVCSSVARSALRVAFHDAMGWSSNTTTNLGNGADGSILVFDCVEMEYAANERLGVAVSVLQPFLNNHNISAGDFLQFTAAVGLTTCPGAPAIPYFFGRPDPIQPAADGTIPLPSDSVDQILARFSDVGFDPTDVVALLGAHSIASADINDDTTTVPYLDSTPQVFDVEFYKEVLLPGTISNNSIEPTDTTASPFTWEIRLKSDANIAADIRTQSTWQTLINNPSTFGSAFSEVMAQLSILGNDPETLIDCSDMIPAPMPAPPPNTGAIVEPIRCDKSIQNAKKCLIFIFGGGAVG*

Retrieve as FASTA  
Remarks incorrect sequence from genomics (6 introns). 5'end added.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAGCAATTCGCCAGGGTTAGTGACCGCCCACATGTTTATAAACTCTGTTAACCTTTAGATATAGCATTGGCGGATTCGTTTGTATGCCCTCAAGGACAGACCGTTCAAAATGCAGA
ATGTTGCGCTTTAATTCCAGTTTTAGAAGACTTACAAACGAACTACTTCGCCGGTGAAGTTTGTAGCTCAGTA
GTCAGTGTACTCTTTATTGAAGCACTAATTAATGATAATAAACAATT
ATATGCCTCATCAAATAGGCAAGATCAGCGTTGCGTGTAGCCTTTCACGATGCAATGGGATGGTCCTCAAACACCACTACTAATTTAGGGAATGGAGCGGATGGATCCATCTTAGTGTTT
GACTGCGTTGAGATGGAATATGCAGCAAACGAGAGGCTTGGTGTGGCAGTTTCTGTATTACAGCCATTCCTTAACAACCACAATATTTCAGCCGGTGATTT
GTAGGTCCAATAATTTCAT
ATTGCCTTGAGATAATATTCAAAATATATCCTAGCCTTCAATTCACTGCAGCTGTCGGTTTGACTACTTGTCCCGGTGCTCCCGCTATCCCTTACTTCTTCGGTCGACCAGATCCGATCC
AACCGGCTGCGGATGGAACTATCCCCTTGCCTAGTG
GTGAGAACACATCACCCAATATACGCGCCTCCTTACATAACTACATTTTAGATTCTGTTGATCAAATTCTTGCGAGATTCTCTG
ATGTGGGGTTCGACCCTACTGATGTTGTTGCCCTTCTTGGAGCACACTCCATAGCATCTGCGGACATAAATGATGATACAACCACTGT
GTACGTATTATATTCACCATCCAATCCATCAC
TATTATTCAAACCTATATTATTCACTTACATTTAGACCATACCTTGACTCCACACCCCAGGTTTTCGACGTTGAGTTCTATAAAGAAGTTCTTCTCCCTGGAACTATTTCAAATAAGTAT
GTTTTCACACATTCCTATAGAAATTGGCTGATTAATTTAATTCTCCGCAGCTCTATTGAACCGACCGATACGACTGCATCTCCTTTCACGTGGGAAATACGTCTTAAGTCAGATGCAAAT
ATTGCTGCAGATATACGAACACAAAGTACATGGCAAACGTTGATCAATAACCCATCCACATTTGGCTCGGCATTCAGCGAAGTTATGGCACAGCTATCCATCCTCGGCAATGACCCGGAA
ACGTTAATTGACTGTTCGGATATGATACCAGCTCCTATGCCAGCTCCCCCGCCAAATACCGGGGCAATTGTGGAACCTATTAGGTGCGATAAATCAATTCAAAATGCAAAGAAATGTCTC
ATTTTCATTTTTGGTGGTGGGGCGGTAGGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAGCAATTCGCCAGGATATAGCATTGGCGGATTCGTTTGTATGCCCTCAAGGACAGACCGTTCAAAATGCAGAATGTTGCGCTTTAATTCCAGTTTTAGAAGACTTACAAACGAAC
TACTTCGCCGGTGAAGTTTGTAGCTCAGTA
GCAAGATCAGCGTTGCGTGTAGCCTTTCACGATGCAATGGGATGGTCCTCAAACACCACTACTAATTTAGGGAATGGAGCGGATGGATCC
ATCTTAGTGTTTGACTGCGTTGAGATGGAATATGCAGCAAACGAGAGGCTTGGTGTGGCAGTTTCTGTATTACAGCCATTCCTTAACAACCACAATATTTCAGCCGGTGATTT
CCTTCAA
TTCACTGCAGCTGTCGGTTTGACTACTTGTCCCGGTGCTCCCGCTATCCCTTACTTCTTCGGTCGACCAGATCCGATCCAACCGGCTGCGGATGGAACTATCCCCTTGCCTAGTG
ATTCT
GTTGATCAAATTCTTGCGAGATTCTCTGATGTGGGGTTCGACCCTACTGATGTTGTTGCCCTTCTTGGAGCACACTCCATAGCATCTGCGGACATAAATGATGATACAACCACTGT
ACCA
TACCTTGACTCCACACCCCAGGTTTTCGACGTTGAGTTCTATAAAGAAGTTCTTCTCCCTGGAACTATTTCAAATAA
CTCTATTGAACCGACCGATACGACTGCATCTCCTTTCACGTGG
GAAATACGTCTTAAGTCAGATGCAAATATTGCTGCAGATATACGAACACAAAGTACATGGCAAACGTTGATCAATAACCCATCCACATTTGGCTCGGCATTCAGCGAAGTTATGGCACAG
CTATCCATCCTCGGCAATGACCCGGAAACGTTAATTGACTGTTCGGATATGATACCAGCTCCTATGCCAGCTCCCCCGCCAAATACCGGGGCAATTGTGGAACCTATTAGGTGCGATAAA
TCAATTCAAAATGCAAAGAAATGTCTCATTTTCATTTTTGGTGGTGGGGCGGTAGGC

Retrieve as FASTA