Entry information : SsteMnP14
Entry ID 12333
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP14
Name SsteMnP14
Class Manganese peroxidase     [Orthogroup: MnP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP14
start..stop
S start..stop
GmorcMnP13 303 3e-101 17..364 21..368
SsteMnP17 301 1e-100 10..364 6..367
RrubMnP13 300 3e-100 5..351 6..354
RrubMnP11 299 9e-100 10..364 6..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 78633..78821 189 N° 2 78872..79083 212 N° 3 79142..79263 122 N° 4 79320..79443 124
N° 5 79515..79595 81 N° 6 79649..80018 370  
join(78633..78821,78872..79083,79142..79263,79320..79443,79515..79595,79649..800 18)


exon

Literature and cross-references SsteMnP14
DNA ref. JGI genome:   scaffold_109 (78633..80018)
Cluster/Prediction ref. JGI gene:   121579
Protein sequence: SsteMnP14
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (344)
PWM (Da):   %s   38497.25 (35822.6)  
PI (pH):   %s   4.37 (4.13) Peptide Signal:   %s   cut: 23 range:23-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVVLLFHLLLLLYLRVSVRVIATALCPDGTSAPNGSQQCCPFVELLADIQQNLTGTTACTNLVARNVLRLAFHDAMGASASLTSQGQFGGGGADGSILVFPQETTYIANEGFNLTVFLLQPFLERNPSVSPGDFLQFAAAVGLATCPGAPQVKFLAGRPSPIAAAPDQLIPEPTDSVTTILNRFNDAGGFAPAEVVALMAGHSIALNYHLEVVNLRTPFDSTPDVFDTQFYLDVLLNGTVTPNVTDPTMFSTSPFNGELRLLSDAALARDSRTACTWQGFVNQQTSMQQAFSAAWAKMSVIGQSTQALVDCSSLVPTPPSLSSTQNSATFMGGTTQSNIQQAPACSSAFPSNISTSSAVFTATPLL*

Retrieve as FASTA  
Remarks incorrect prediction from genomics (5 introns). 5' and 3' end added.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGTCTTGCTCTTCCATCTTTTACTCTTGCTATACTTACGAGTATCAGTCCGTGTCATAGCAACCGCTTTATGTCCAGACGGAACGTCTGCTCCAAATGGATCCCAACAATGCTGT
CCTTTTGTGGAACTTCTAGCAGATATCCAACAAAATTTGACCGGCACAACCGCCTGTACCAACTTGGTA
GTATCTTTCTGCTTTCTTTTGTTTGATCATACTCAAGTTAGTAATTCAAGG
CCAGAAACGTGCTTCGTCTTGCATTTCATGACGCCATGGGTGCCTCAGCCAGCCTAACAAGCCAAGGACAATTCGGCGGTGGCGGTGCTGATGGCTCAATTCTGGTATTTCCTCAGGAGA
CCACATACATTGCAAATGAGGGATTCAACCTGACTGTATTCTTACTTCAACCCTTTCTAGAGAGAAATCCGAGTGTTTCTCCCGGTGATTT
GTAAGATAAATCATAACGCGTAGCTATAA
GATCCTCACGGCCTTGACACCATGTATAGTCTTCAGTTTGCTGCCGCTGTGGGTCTTGCCACGTGTCCTGGAGCACCCCAGGTAAAATTTCTCGCTGGCCGACCTTCTCCAATAGCTGCT
GCACCGGATCAATTGATTCCAGAGCCAACCG
GTATGTCTGTCCACTCCACAACGGAAGTATAATAATAGGTTGAACGCAATGTACAGACAGTGTCACTACAATTCTGAATCGCTTTAACG
ATGCAGGAGGATTCGCACCGGCTGAAGTTGTTGCACTGATGGCTGGCCACAGCATCGCGCTAAATTACCACTTGGAAGTAGTCAATCTTAG
GTAGGTAAGGAGTTGACTGTCTGGACTCA
TTGCACTACTAACCGGAGTTTTGCCTTGATTCCCCGTTTTAGAACGCCTTTTGATTCAACTCCTGATGTTTTCGACACACAATTTTATCTTGATGTACTTCTGAATGGCACCGTTACTCC
AAA
GTAAGCTTCGTAGTAATGTGGTGCATAGATCTCTCAGCTAAGGATATGAACAGCGTCACTGACCCAACAATGTTTTCAACCTCTCCTTTCAATGGCGAACTTCGCTTATTATCAGAC
GCTGCATTAGCCAGAGATAGCAGAACTGCCTGTACCTGGCAAGGGTTTGTGAATCAACAGACTTCAATGCAACAAGCATTCAGCGCCGCATGGGCTAAAATGTCTGTCATAGGTCAATCC
ACACAGGCATTAGTTGATTGCTCGAGCCTGGTGCCCACTCCCCCTTCACTGAGTTCAACGCAAAACTCAGCTACCTTTATGGGCGGTACCACGCAAAGTAATATTCAACAAGCGCCGGCG
TGCTCCTCTGCATTTCCTAGTAACATATCAACCTCCTCCGCGGTATTTACAGCCACCCCACTCCTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGTCTTGCTCTTCCATCTTTTACTCTTGCTATACTTACGAGTATCAGTCCGTGTCATAGCAACCGCTTTATGTCCAGACGGAACGTCTGCTCCAAATGGATCCCAACAATGCTGT
CCTTTTGTGGAACTTCTAGCAGATATCCAACAAAATTTGACCGGCACAACCGCCTGTACCAACTTGGTA
GCCAGAAACGTGCTTCGTCTTGCATTTCATGACGCCATGGGTGCCTCAGCC
AGCCTAACAAGCCAAGGACAATTCGGCGGTGGCGGTGCTGATGGCTCAATTCTGGTATTTCCTCAGGAGACCACATACATTGCAAATGAGGGATTCAACCTGACTGTATTCTTACTTCAA
CCCTTTCTAGAGAGAAATCCGAGTGTTTCTCCCGGTGATTT
TCTTCAGTTTGCTGCCGCTGTGGGTCTTGCCACGTGTCCTGGAGCACCCCAGGTAAAATTTCTCGCTGGCCGACCTTCT
CCAATAGCTGCTGCACCGGATCAATTGATTCCAGAGCCAACCG
ACAGTGTCACTACAATTCTGAATCGCTTTAACGATGCAGGAGGATTCGCACCGGCTGAAGTTGTTGCACTGATGGCT
GGCCACAGCATCGCGCTAAATTACCACTTGGAAGTAGTCAATCTTAG
AACGCCTTTTGATTCAACTCCTGATGTTTTCGACACACAATTTTATCTTGATGTACTTCTGAATGGCACCGTT
ACTCCAAA
CGTCACTGACCCAACAATGTTTTCAACCTCTCCTTTCAATGGCGAACTTCGCTTATTATCAGACGCTGCATTAGCCAGAGATAGCAGAACTGCCTGTACCTGGCAAGGGTTT
GTGAATCAACAGACTTCAATGCAACAAGCATTCAGCGCCGCATGGGCTAAAATGTCTGTCATAGGTCAATCCACACAGGCATTAGTTGATTGCTCGAGCCTGGTGCCCACTCCCCCTTCA
CTGAGTTCAACGCAAAACTCAGCTACCTTTATGGGCGGTACCACGCAAAGTAATATTCAACAAGCGCCGGCGTGCTCCTCTGCATTTCCTAGTAACATATCAACCTCCTCCGCGGTATTT
ACAGCCACCCCACTCCTG

Retrieve as FASTA