Entry information : SsteMnP15
Entry ID 12334
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-20 (Catherine Mathe (Scipio))
Peroxidase information: SsteMnP15
Name SsteMnP15
Class Manganese peroxidase    [Orthogroup: MnP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sphaerobolaceae Sphaerobolus
Organism Sphaerobolus stellatus    [TaxId: 68786 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsteMnP15
start..stop
S start..stop
SsteMnP20 715 0 1..376 1..376
SsteMnP03 667 0 1..376 1..376
RrubMnP07 619 0 1..376 1..378
RrubMnP06 617 0 1..375 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1213277..1213431 155 N° 2 1213163..1213215 53 N° 3 1212577..1213104 528 N° 4 1212422..1212515 94
N° 5 1212203..1212364 162 N° 6 1212045..1212146 102 N° 7 1211957..1211990 34  
complement(join(1211957..1211990,1212045..1212146,1212203..1212364,1212422..1212 515,1212577..1213104,1213163..1213215,1213277..1213431))


exon

Literature and cross-references SsteMnP15
DNA ref. JGI genome:   scaffold_7 (1213431..1211957)
Cluster/Prediction ref. JGI gene:   155577
Protein sequence: SsteMnP15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376 (358)
PWM (Da):   %s   39458.54 (37522.5)  
PI (pH):   %s   4.43 (4.38) Peptide Signal:   %s   cut: 19 range:19-376
Sequence 418
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLAAFATLATLVQAMPATQLVTCPDGNKASNAACCPFFALRDDLQANLFDNQCGEDAHESVRLTFHDAIAFSSSLKAQGKPAGGGADGSMLIFPDVEPNFAANLGISDSVDSLLPFLATHPVTAGDLIQFAGAVAVSNCPGAPRLEFLAGRPNATAPAPDGLIPEPQDDVEKIFSRFADGGGFAPAEIIALLASHTIARADHVDPTLDAAPFDSTPFTFDTQIFLEVLLKGVGFPGTGNNTGELASPLPTTFEKDVGELRLQSDFALARHPTTACTWQGFVNEQEKMANAFKLAMAKLAVNGQDTRNFVDCSEVVPIPVPAVKKPATFPATKTRADVQQACFASPFPNLTSDKGAVETLIPHCPDGTMNCTS*

Retrieve as FASTA  
Remarks complete sequence from genomics (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGACTCTCGCTGCCTTCGCTACTCTTGCCACCCTTGTGCAGGCCATGCCAGCCACTCAGCTGGTTACTTGCCCTGATGGCAACAAGGCATCGAACGCTGCCTGCTGCCCA
TTCTTCGCCCTCCGCGATGATCTCCAGGCTAACTT
GTACGTGCCCCGTATTTGAGTCAGATTGGAAGAATATTCACATATTTTTTCTTATGTATAGGTTCGACAACCAATGCGGTGAAGA
TGCTCACGAATCCGTCCGTCTTACTTTCC
GTCAGTAAATATTAAAAACGCCACTGGTTAATCACTGCTTACTGAATAATATATTCAGACGACGCCATCGCCTTCTCGAGCTCCTTGAAGG
CTCAAGGAAAGCCCGCCGGTGGAGGAGCTGACGGTTCCATGCTTATCTTCCCCGACGTCGAACCCAACTTCGCCGCCAACCTCGGTATTTCCGACAGTGTCGACTCCCTTTTGCCATTCC
TTGCAACCCACCCAGTCACCGCAGGCGATCTTATCCAGTTCGCAGGTGCAGTTGCCGTCAGCAACTGTCCGGGTGCCCCGAGGTTGGAATTCTTGGCTGGTCGTCCCAACGCGACTGCTC
CCGCTCCCGATGGTCTCATCCCTGAGCCTCAAGACGACGTTGAGAAGATCTTCTCTCGTTTCGCTGACGGTGGAGGATTCGCCCCCGCTGAAATCATTGCCTTGTTGGCTTCCCACACCA
TCGCTCGTGCTGACCACGTTGACCCGACTCTCGATGCTGCTCCCTTCGATTCCACTCCTTTCACTTTCGACACCCAAATCTTCCTGGAGGTCCTTCTCAAGGGCGTTGGCTTCCCCGGAA
CTGGCAACAACACTG
GTAAGTTTTTATATTTCTCCAAGATATTTCTAATTATCTTACCATTGTCATTGAATAACAGGTGAACTTGCATCTCCTCTCCCTACCACCTTCGAGAAGGACGTC
GGTGAACTCCGTCTCCAATCTGATTTCGCCCTTGCTCGTCACCCCACCAC
GTACGTCGACTTTAATTTTTAAAATGGACCTCTTTTTAATTTTCTTTCGTTATCTAGTGCCTGCACATGG
CAAGGATTCGTCAACGAGCAAGAAAAGATGGCCAACGCCTTCAAACTTGCTATGGCTAAGCTTGCCGTCAACGGTCAGGACACCAGGAACTTCGTTGACTGCTCTGAGGTCGTCCCCATC
CCGGTCCCCGCTGTCAAGAAGCCTGCTAC
GTATGTCAATATCTCTTTAATATGTTCGTCCAAATGCTCACCTTTATATTCTATAGCTTCCCCGCTACCAAGACCAGAGCTGACGTTCAGC
AAGCTTGCTTCGCTTCGCCTTTCCCCAACCTCACTTCCGATAAGGGTGCAGTCGAGACGCTCATTCC
GTATGTTGCCATTTTCGATGTTTAGGATTACGACTAATCCCTTTTCATATACA
GTCACTGCCCCGACGGAACCATGAACTGCACCTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGACTCTCGCTGCCTTCGCTACTCTTGCCACCCTTGTGCAGGCCATGCCAGCCACTCAGCTGGTTACTTGCCCTGATGGCAACAAGGCATCGAACGCTGCCTGCTGCCCA
TTCTTCGCCCTCCGCGATGATCTCCAGGCTAACTT
GTTCGACAACCAATGCGGTGAAGATGCTCACGAATCCGTCCGTCTTACTTTCCACGACGCCATCGCCTTCTCGAGCTCCTTGAAG
GCTCAAGGAAAGCCCGCCGGTGGAGGAGCTGACGGTTCCATGCTTATCTTCCCCGACGTCGAACCCAACTTCGCCGCCAACCTCGGTATTTCCGACAGTGTCGACTCCCTTTTGCCATTC
CTTGCAACCCACCCAGTCACCGCAGGCGATCTTATCCAGTTCGCAGGTGCAGTTGCCGTCAGCAACTGTCCGGGTGCCCCGAGGTTGGAATTCTTGGCTGGTCGTCCCAACGCGACTGCT
CCCGCTCCCGATGGTCTCATCCCTGAGCCTCAAGACGACGTTGAGAAGATCTTCTCTCGTTTCGCTGACGGTGGAGGATTCGCCCCCGCTGAAATCATTGCCTTGTTGGCTTCCCACACC
ATCGCTCGTGCTGACCACGTTGACCCGACTCTCGATGCTGCTCCCTTCGATTCCACTCCTTTCACTTTCGACACCCAAATCTTCCTGGAGGTCCTTCTCAAGGGCGTTGGCTTCCCCGGA
ACTGGCAACAACACTG
GTGAACTTGCATCTCCTCTCCCTACCACCTTCGAGAAGGACGTCGGTGAACTCCGTCTCCAATCTGATTTCGCCCTTGCTCGTCACCCCACCACTGCCTGCACA
TGGCAAGGATTCGTCAACGAGCAAGAAAAGATGGCCAACGCCTTCAAACTTGCTATGGCTAAGCTTGCCGTCAACGGTCAGGACACCAGGAACTTCGTTGACTGCTCTGAGGTCGTCCCC
ATCCCGGTCCCCGCTGTCAAGAAGCCTGCTAC
CTTCCCCGCTACCAAGACCAGAGCTGACGTTCAGCAAGCTTGCTTCGCTTCGCCTTTCCCCAACCTCACTTCCGATAAGGGTGCAGTC
GAGACGCTCATTCC
TCACTGCCCCGACGGAACCATGAACTGCACCTC

Retrieve as FASTA