Entry information : AimmGPx01
Entry ID 12420
Creation 2013-06-04 (Nizar Fawal)
Last sequence changes 2013-06-04 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-24 (Catherine Mathe (Scipio))
Peroxidase information: AimmGPx01
Name AimmGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Pezizomycetes Ascobolaceae Ascobolus
Organism Ascobolus immersus    [TaxId: 5191 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AimmGPx01
start..stop
S start..stop
MfiGPx01 228 8.69e-77 8..166 59..219
MbicuGPx02 223 4.59e-76 7..164 1..158
AoliGPx01 224 5.62e-76 1..170 1..170
PrubGPx01 225 8.04e-76 2..165 55..218
Gene structure Fichier Exons


exon

Literature and cross-references AimmGPx01
DNA ref. JGI genome:   scaffold_1 (1249876..1249250)
Cluster/Prediction ref. JGI gene:   368058
Protein sequence: AimmGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   18820.64  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSASVPQSFYDLVAKDAKGQDFKFSDLKGKPVLIVNVASKCGFTGQYAGLQQLHEKYGSKGLQILGFPCNQFGGQEPGEDSDIQSFCSLNYGVSFPVLGKVEVNGDNASPVWEFLKNKKS
GLLGLKRIKWNFEKFLVSKDGEVVERWASTSTPASLESAIEKELAKLNKSEL*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
CDS
Send to BLAST