Entry information : ZmaPrx14 ( Zosma22g00590 [2.2])
Entry ID 12533
Creation 2013-11-05 (Qiang Li)
Last sequence changes 2016-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-11 (Achraf Jemmat)
Peroxidase information: ZmaPrx14 ( Zosma22g00590 [2.2])
Name (synonym) ZmaPrx14 ( Zosma22g00590 [2.2])
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaPrx14
start..stop
S start..stop
GrPrx02 422 6e-149 14..343 9..337
JcPrx01 419 5e-148 17..343 8..332
PtPrx37 414 1e-145 18..348 12..341
RcPrx14 413 3e-145 17..343 12..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 514765..515028 264 N° 2 515102..515441 340 N° 3 515534..515982 449  
join(514765..515028,515102..515441,515534..515982)


exon

Literature and cross-references ZmaPrx14 ( Zosma22g00590 [2.2])
DNA ref. Phytozome 12:   scaffold_22 (514765..515982)
Cluster/Prediction ref. Phytozome Gene 12:   33171716
Protein sequence: ZmaPrx14 ( Zosma22g00590 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351
PWM (Da):   %s   38931.7 Transmb domain:   %s   i13-35o
PI (pH):   %s   8.12
Sequence 392
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGPEVEEIEMKSGIVILVLVLMCVLEKTVAVDVVIPFGSLKLHYYKTTDTCKYAEEYVKHQVGLAWKKDRTVTASLLRLVYSDCFITGCDGSILLDGPDTEKMAPQNYGLKGFDVVDRIKKVMEAYCPGVVSCSDILHLATKEAVALAGAPKYPVFTGRRDAMTSTKASVDLPSPSISWNQALEYFQSRGLDVLDLGTLLGAHSLGKTRCSSIYDRLYNYNKTGTRDPTLKLSFFRTLRSQCPKDSRTANPATSPFVYLNPDSGSSYNFSNSYYSRVLRNEAVLGVDQQFIFSSDGIRIADEFSAIFEDFRRSFALAMYRMGSIGVLTGNEGEIRKQCRFTNANNPNLK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGAGGACCGGAAGTGGAGGAAATCGAAATGAAATCAGGTATAGTAATTCTGGTTCTAGTTTTGATGTGTGTTTTGGAGAAGACAGTCGCCGTTGACGTCGTGATACCATTTGGATCAC
TGAAGTTACACTACTACAAAACCACCGATACGTGCAAGTACGCGGAGGAGTACGTCAAGCATCAAGTCGGTTTGGCATGGAAGAAAGATCGAACCGTCACAGCCAGTCTCCTCCGTCTCG
TCTACTCCGACTGCTTCATCACT
GTACGTGCATGTGATGTCGCTTATCCGATCTTCCGGTTTATAGGTATATAATACGTTTAAATACATGCAACAGGGTTGTGATGGCTCGATCCTATTG
GACGGACCGGACACGGAGAAAATGGCACCGCAGAACTACGGATTGAAAGGGTTCGACGTCGTTGACAGGATCAAGAAAGTCATGGAAGCTTATTGTCCTGGTGTTGTTTCTTGTTCGGAC
ATACTTCACCTGGCCACCAAAGAAGCCGTTGCACTGGCCGGTGCACCCAAGTATCCGGTGTTCACCGGAAGGAGAGATGCCATGACATCGACCAAAGCTTCCGTCGACCTTCCATCACCT
TCTATTTCTTGGAATCAAGCTCTTGAATACTTCCAATCCAGAGGTCTTGATGTTCTCGATCTTGGCACACTCCTAG
GTAACGACAAAATTAATTAAGATCTATGGATCGGATCATCGGAG
CTTGTCTCTCTAGCTATTATGTGTATATATATGTATGCATTATTTCAGGCGCTCACAGCTTGGGTAAGACAAGATGCAGCAGTATTTACGACCGACTCTACAACTACAACAAGACCGGAA
CGCGTGATCCAACGCTAAAACTTTCCTTCTTCAGAACTCTCCGGTCGCAATGCCCAAAAGATAGCCGGACGGCCAATCCTGCGACCTCACCGTTCGTGTACCTGAATCCAGACTCAGGCA
GTAGCTACAACTTTTCAAACTCATACTACTCTCGTGTCCTCCGCAATGAAGCCGTTCTTGGCGTGGACCAGCAGTTCATATTCTCCAGTGACGGTATTCGTATTGCCGATGAGTTCTCTG
CGATATTTGAAGACTTCCGACGCTCCTTCGCTCTGGCAATGTACCGGATGGGAAGCATCGGAGTGCTCACTGGCAACGAAGGGGAGATTCGAAAGCAATGTCGGTTCACCAATGCCAATA
ATCCCAACTTGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGAGGACCGGAAGTGGAGGAAATCGAAATGAAATCAGGTATAGTAATTCTGGTTCTAGTTTTGATGTGTGTTTTGGAGAAGACAGTCGCCGTTGACGTCGTGATACCATTTGGATCAC
TGAAGTTACACTACTACAAAACCACCGATACGTGCAAGTACGCGGAGGAGTACGTCAAGCATCAAGTCGGTTTGGCATGGAAGAAAGATCGAACCGTCACAGCCAGTCTCCTCCGTCTCG
TCTACTCCGACTGCTTCATCACT
GGTTGTGATGGCTCGATCCTATTGGACGGACCGGACACGGAGAAAATGGCACCGCAGAACTACGGATTGAAAGGGTTCGACGTCGTTGACAGGATCA
AGAAAGTCATGGAAGCTTATTGTCCTGGTGTTGTTTCTTGTTCGGACATACTTCACCTGGCCACCAAAGAAGCCGTTGCACTGGCCGGTGCACCCAAGTATCCGGTGTTCACCGGAAGGA
GAGATGCCATGACATCGACCAAAGCTTCCGTCGACCTTCCATCACCTTCTATTTCTTGGAATCAAGCTCTTGAATACTTCCAATCCAGAGGTCTTGATGTTCTCGATCTTGGCACACTCC
TAG
GCGCTCACAGCTTGGGTAAGACAAGATGCAGCAGTATTTACGACCGACTCTACAACTACAACAAGACCGGAACGCGTGATCCAACGCTAAAACTTTCCTTCTTCAGAACTCTCCGGT
CGCAATGCCCAAAAGATAGCCGGACGGCCAATCCTGCGACCTCACCGTTCGTGTACCTGAATCCAGACTCAGGCAGTAGCTACAACTTTTCAAACTCATACTACTCTCGTGTCCTCCGCA
ATGAAGCCGTTCTTGGCGTGGACCAGCAGTTCATATTCTCCAGTGACGGTATTCGTATTGCCGATGAGTTCTCTGCGATATTTGAAGACTTCCGACGCTCCTTCGCTCTGGCAATGTACC
GGATGGGAAGCATCGGAGTGCTCACTGGCAACGAAGGGGAGATTCGAAAGCAATGTCGGTTCACCAATGCCAATAATCCCAACTTGAAGTAA

Retrieve as FASTA