Entry information : ZmaPrx11 (Zosma118g00340 [2.2])
Entry ID 12546
Creation 2013-11-05 (Qiang Li)
Last sequence changes 2016-04-08 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-11 (Christophe Dunand)
Peroxidase information: ZmaPrx11 (Zosma118g00340 [2.2])
Name (synonym) ZmaPrx11 (Zosma118g00340 [2.2])
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaPrx11
start..stop
S start..stop
OsPrx16 386 2e-134 27..342 19..331
SpPrx01 379 1e-131 30..341 21..338
ZmPrx39 375 6e-130 11..346 1..341
SbPrx115 375 7e-130 30..341 21..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 311869..312105 237 N° 2 310952..311797 846  
complement(join(310952..311797,311869..312105))


exon

Literature and cross-references ZmaPrx11 (Zosma118g00340 [2.2])
DNA ref. Phytozome 12:   scaffold_118 (312105..10952)
Cluster/Prediction ref. Phytozome Gene 12:   33178603
Protein sequence: ZmaPrx11 (Zosma118g00340 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (328)
PWM (Da):   %s   38996.28 (35438.3)  
PI (pH):   %s   4.63 (4.48) Peptide Signal:   %s   cut: 33 range:33-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANYNSLRTKLTTMLKLVVVLSLSLLAAGVNGELNVGFYQNTCPNAESLIQQAVSDAFANNSGVAPGLLRMHFHDCFVRGCDGSVLLDGNDTEKTSIPNLSLRSVAFDLIDDAKTAVEKECPGIVSCADILAFAARDSANLTGGVTWDVPAGRRDGNMSIASEALTNLPPPSFNATQLVDRFKEKNLTAEEMVLLSGAHTLGRSHCVSFTKRLYQNTSIPDSAAQTDPTLSLAYADLLRNLCPSNSNATDTVTTLMDLITPNTLDNKYYLGVMNNLGLFKSDQALMTQDDLLAFVQEFNANATEWATKFGAAMVQMGRFDVLEGTNGEIRTNCRAVNAANSNSATVKNLLINMYRNYEEW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAACTATAACTCACTCAGAACAAAATTAACAACAATGCTAAAGCTTGTGGTAGTTTTATCGCTTTCGTTACTCGCCGCCGGCGTCAACGGGGAGTTGAACGTTGGGTTCTATCAA
AACACTTGTCCCAATGCAGAATCTCTCATCCAGCAAGCCGTCTCTGATGCTTTTGCGAACAATTCAGGCGTCGCTCCTGGACTTTTACGCATGCACTTCCATGACTGTTTCGTTAGG
GTG
GGTGCTGATATATTTTGATATATATTAAGGTTCATTTCATAATTTAGTTTTGTCTTGTACTTGTACAGGGATGCGACGGCTCGGTTTTGCTCGACGGAAATGACACCGAGAAGACATCCA
TTCCAAATCTAAGTCTTCGTTCCGTGGCCTTCGACTTGATTGACGATGCGAAAACCGCCGTCGAGAAAGAATGTCCCGGTATTGTCTCTTGTGCCGACATCCTTGCTTTTGCAGCTCGTG
ATAGCGCCAATCTCACCGGGGGTGTGACATGGGATGTTCCCGCCGGACGTAGAGATGGGAATATGTCTATCGCCAGTGAGGCTTTAACAAATCTTCCACCACCTTCCTTTAACGCCACAC
AACTTGTTGACCGGTTTAAAGAGAAGAATCTCACCGCAGAGGAGATGGTTCTACTCTCCGGTGCACATACCTTGGGTAGATCCCACTGCGTCTCTTTCACCAAACGGCTCTACCAAAACA
CTTCGATACCAGACAGTGCCGCCCAAACCGACCCGACTCTGAGTCTGGCGTATGCTGATCTTCTTAGAAACCTCTGTCCGTCCAATAGCAACGCAACCGACACGGTCACGACTCTGATGG
ACCTCATCACGCCCAACACTCTGGACAACAAGTACTACCTGGGTGTGATGAACAATCTGGGTCTGTTTAAGTCCGATCAAGCGCTCATGACGCAGGATGATCTGTTGGCGTTTGTACAGG
AGTTCAACGCGAATGCTACTGAGTGGGCGACCAAGTTCGGAGCTGCGATGGTGCAAATGGGTAGGTTCGATGTTCTTGAGGGCACGAATGGAGAGATTAGAACCAACTGCAGAGCTGTAA
ACGCTGCTAATAGTAACAGTGCCACCGTCAAAAATCTACTTATCAATATGTACAGAAACTACGAAGAATGGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAACTATAACTCACTCAGAACAAAATTAACAACAATGCTAAAGCTTGTGGTAGTTTTATCGCTTTCGTTACTCGCCGCCGGCGTCAACGGGGAGTTGAACGTTGGGTTCTATCAA
AACACTTGTCCCAATGCAGAATCTCTCATCCAGCAAGCCGTCTCTGATGCTTTTGCGAACAATTCAGGCGTCGCTCCTGGACTTTTACGCATGCACTTCCATGACTGTTTCGTTAGG
GGA
TGCGACGGCTCGGTTTTGCTCGACGGAAATGACACCGAGAAGACATCCATTCCAAATCTAAGTCTTCGTTCCGTGGCCTTCGACTTGATTGACGATGCGAAAACCGCCGTCGAGAAAGAA
TGTCCCGGTATTGTCTCTTGTGCCGACATCCTTGCTTTTGCAGCTCGTGATAGCGCCAATCTCACCGGGGGTGTGACATGGGATGTTCCCGCCGGACGTAGAGATGGGAATATGTCTATC
GCCAGTGAGGCTTTAACAAATCTTCCACCACCTTCCTTTAACGCCACACAACTTGTTGACCGGTTTAAAGAGAAGAATCTCACCGCAGAGGAGATGGTTCTACTCTCCGGTGCACATACC
TTGGGTAGATCCCACTGCGTCTCTTTCACCAAACGGCTCTACCAAAACACTTCGATACCAGACAGTGCCGCCCAAACCGACCCGACTCTGAGTCTGGCGTATGCTGATCTTCTTAGAAAC
CTCTGTCCGTCCAATAGCAACGCAACCGACACGGTCACGACTCTGATGGACCTCATCACGCCCAACACTCTGGACAACAAGTACTACCTGGGTGTGATGAACAATCTGGGTCTGTTTAAG
TCCGATCAAGCGCTCATGACGCAGGATGATCTGTTGGCGTTTGTACAGGAGTTCAACGCGAATGCTACTGAGTGGGCGACCAAGTTCGGAGCTGCGATGGTGCAAATGGGTAGGTTCGAT
GTTCTTGAGGGCACGAATGGAGAGATTAGAACCAACTGCAGAGCTGTAAACGCTGCTAATAGTAACAGTGCCACCGTCAAAAATCTACTTATCAATATGTACAGAAACTACGAAGAATGG
TAA

Retrieve as FASTA