Entry information : ZmaAPx02 ( Zosma21g01150 [2.2])
Entry ID 12567
Creation 2013-11-05 (Qiang Li)
Last sequence changes 2016-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-11 (Achraf Jemmat)
Peroxidase information: ZmaAPx02 ( Zosma21g01150 [2.2])
Name (synonym) ZmaAPx02 ( Zosma21g01150 [2.2])
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaAPx02
start..stop
S start..stop
ZaAPx02 444 2e-159 5..284 4..286
LsaAPx02 442 1e-158 5..284 4..283
LuAPx79 439 2e-157 5..284 4..283
CroAPx03 438 5e-157 1..285 1..290
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 959056..959171 116 N° 2 959275..959399 125 N° 3 960185..960234 50 N° 4 961200..961265 66
N° 5 961385..961433 49 N° 6 961752..961834 83 N° 7 961942..962021 80 N° 8 962142..962244 103
N° 9 962316..962504 189  
join(959056..959171,959275..959399,960185..960234,961200..961265,961385..961433, 961752..961834,961942..962021,962142..962244,962316..962504)


exon

Literature and cross-references ZmaAPx02 ( Zosma21g01150 [2.2])
DNA ref. Phytozome 12:   scaffold_21 (959056..962504)
Cluster/Prediction ref. Phytozome Gene 12:   33168903
Protein sequence: ZmaAPx02 ( Zosma21g01150 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31662.37 Transmb domain:   %s   o257-279i
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPPVVDVEYRKEIEKARRDLRAVISSKNCAPIMLRLAWHDAGTFDVKTKIGGPNGSIRNKEELNHAANSGLKFSIDLCEIVKAKHPKITYADLYQLAGVVAVEVTGGPTIEFVPGRKDSLVSPREGNLPDAKQGTEHLREIFYRMGLSDKDIVALSGAHTLGRAHQERSGFEGPWTKEPLKFDNTYFVELLEGEKKGLLKLPTDNTLLHDPAFRGYVELYAKDEDAFFRDYTVSHKKLSELGCFAPTSNKADSNGFLVHSAFGVAVTAAVVILSYCFEVSRKKM*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCCCCCCAGTAGTTGACGTGGAGTATCGCAAAGAGATCGAGAAGGCCAGGAGAGATCTCCGTGCTGTAATCTCTAGCAAGAACTGTGCCCCCATCATGCTCCGCCTCGCGTAT
GTTCTTCTGTTCAGTCCCCATTCACTGTTCCCATCAGTCCTTCTGATCTCTTGCTTTGGAGTTTTCTTCTTTCTTTTTTATGTTCGATCCCTTTTGCAGGTGGCATGATGCCGGGACATT
CGATGTCAAGACAAAGATAGGTGGACCAAATGGTTCGATCAGAAACAAAGAGGAGTTGAATCATGCTGCCAATTCTGGACTGAAGTTTTCGATTGATCTTTGCG
GTGAGCTATGGCCGAT
TTTTTTTTCATACTAAAATACTCATATTAGGTCGAAAGGGACTAACTGTACATGTATTATTGTGTTGTAATGCTTGAAATTCCTTTTTCATAGCATTCTTTCTTCCATTTATTATCTTTA
TCTTTAGAGGCTTGTTCTATAACAAGCTAATTCTATTTCAACATTTATCTTTTAGATAATCTTTCAAATTTCACTCAAGATCAAAGCACATCAGGCCCAAATACCGCTTCATCAGGGACC
TGATTGAAAAAGGAAGATTTGGACCTGAGAAAAATAACTGAAGATTAGAATGCTGCAAATATGCTTACCAAAACGACGAACATGGAAAAGCTAAGGCTATGCATAACCTTAGTGGGCCTT
CTTGATTGCTGCTAAACATGGAGAGGGTGTGATGGTGGTCAACATTTGTTGATTATTGATGTTTATATAATAGAGTGGAGACTGCTTATTTAATTGGTATCCTTATTGGGCCAATTATAG
TCATTATATGAGTCAAATCTAAGATGATTATACTTTCTCTATGTAGATAGCTATGTAGTTACTGAAAACAGTGAGTCAATAACATTTGTAATAGCTAGCCACCACCAATTTTAATGTGGC
CACCAGATAACTAACAGAATGAACCCACTGGAATCCTTGTAGAAAATATGTGTTTATTACTTTTGTAGAACTGGTTGAGAATTGAGAGCATGTTTTTGTCTATCACAGTCATTACTCCAT
CCAAATACAAAAATACTGACTAATTTCTTTATGTTTAATCACTCATCAGAGATTGTCAAGGCAAAGCATCCTAAAATTACATACGCAGATTTATATCAGGTAGAAAATTTATCATTTCAT
AGTTTCTTTAACTTTTAACTCATATTATGACACTTTTTAAATGCTATTTATTTATTTTACTATTAAGTAGATCTCTGTTTTGATTAGAATTATTAAAATGAGTATATTAAATAGTATGAA
ATTTATCATCTATTGAAATGTGACAAACAGAATTTTATCTTGATGATCCTTCTAAAAAAACTTGGGAAACAGATGATCATTATAAATTTTATTTTTACCAAAAATAACTTTTAAACAATA
TTGGATGTAATCTTATTTTTGATAGCCTAATAAGATAATCACAAATCATGAATAGCAGGTTGAAGTATAGGATAATGAGATAATCTATATATTAAAGAATCCCTATAAATTAACTTCAAA
ACAGCGGAATGAAGAGGAAAGATACCAAATCTCCAATAGAAAAATCTGGTAAAATCTATGACATGAAGTCTCAATGGGAAACCTTATCACAATCTTTGACACTGTAAAAACAGTTGTTAA
CATTTTCTTATTTTCCTAGAAAGCTTCTGCAATGATAGATTCCTAAAAGTATCCTGGTGTCAGTTTTTAAGAATACGACTTTCTAATTTCCATAAATCACAATTCAAAAACAAATACAAT
CTTAGTCTATAGTTGAAAAATAAAATCTTTACTCCATATGTGATTTGACAACTTTAAGAAATCATGCTGGCTCATCGATATATAAATCCAAAACACTGCATGATTTCTTATTGTTGTGAT
ATCTATACTTGTGAGAAAAAAGAAACTATCTTTTGAAAAGTTTAGTTTGTGAAATGTAAAAACACTCTCAACTTACGTTATGGATAATATCCCTCTTTTTACTTTTGTTCATATTTGAAA
TTATGATGGTCATTTGCTTCTATTTGGTTGTAGATACCTGTATTGATTGATAGTTTGTAGTAAGAAAATAATATAAACGTTATTTAAAATGTTCTAATTTTCAGCTTGCTGGAGTTGTCG
CTGTTGAGGTCACTGGGGGTCCAACAATTGAATTTGTTCCAGGAAGAAAG
GTGGGCTATCTTCTAGGATTTTATTTCCATCATATAAACCGATGGTACAATGTTTTATATCCTTTACAGT
GATAATTATTCAATTATAGCTAATTGGGGCCCTTTTGTTTTCCTATCAGGATTCTTTAGTTTCACCTAGGGAGGGAAATCTTCCTGATGCTAAACAAGGTATGTGGAATTGTGTATTGTA
TTTTGGTGTAATTGATTAATGGTAGTTGTTATGATTTTTGTTATAACCACAAATCTTTCATAAATCATAACTTATGTTTAGCCTGAATACTTATTTTTATCATGTGATCCTATTGTAAAT
GCACTTTTCTACATCAGTGTGAACTGTGAAAACTTGCTTGCTGCTGTATTTACTTTCAGACACTCCCTTTATTGTTTTTTAACATTATATTTCTTAAAATTTTTTACAACATTTCCCTAA
GCATGTCTAAACCTTATTATTGTATAGGTTAATTAATAAATGTATTATTATTATAGGCACTGAACATCTGAGAGAAATATTTTACCGAATGGGTCTGTCAGACAAGGATATTGTTGCATT
ATCCGGTGCCCACACTTTG
GTAGTTGTTTCAAAGAATTTTTTTCATGGATTTCTAGATTCAAACTGGTATTTTAACTTTTAATCAATATTGTTGCATTTTTTCCCGACACATTTTTGTAT
GTAAAGGGGAGAGCGCATCAGGAAAGGTCTGGTTTCGAAGGTCCTTGGACAAAGGAACCTCTGAAGTTTGACAATACATACTTTGTGTAAGATCAATACAAAACTCTGATAATTGTTTAA
TATGTTTAAACTTCAGACAGAGGATTTGACTTAAAATGCCCAATTGGGGTTCCTTACTACAAAATGGTCATTATTTCTTCTCATAGGGAACTGCTGGAAGGAGAAAAGAAAGGACTTTTA
AAGCTACCAACGGACAATACTTTACTGCATGATCCTGCATTCCGTGGTTATGTTGAACTGTATGCAAAG
GTACTTGAATAAAATAGCTTATGTTTTTGGAAATTAAAAACTAAACATATT
TGTGGTTTAACACAACACAGGATGAAGATGCATTTTTTAGGGATTATACCGTATCCCATAAGAAGCTCTCTGAACTTGGCTGCTTTGCTCCGACATCCAACAAAGCAGATTCAAATGGTT
TTTTGGTTCATAGTGCTTTTGGAGTTGCCGTTACTGCTGCTGTGGTGATACTGAGTTACTGTTTTGAGGTTTCAAGGAAAAAAATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCCCCCCCAGTAGTTGACGTGGAGTATCGCAAAGAGATCGAGAAGGCCAGGAGAGATCTCCGTGCTGTAATCTCTAGCAAGAACTGTGCCCCCATCATGCTCCGCCTCGCGTGG
CATGATGCCGGGACATTCGATGTCAAGACAAAGATAGGTGGACCAAATGGTTCGATCAGAAACAAAGAGGAGTTGAATCATGCTGCCAATTCTGGACTGAAGTTTTCGATTGATCTTTGC
G
AGATTGTCAAGGCAAAGCATCCTAAAATTACATACGCAGATTTATATCAGCTTGCTGGAGTTGTCGCTGTTGAGGTCACTGGGGGTCCAACAATTGAATTTGTTCCAGGAAGAAAGGAT
TCTTTAGTTTCACCTAGGGAGGGAAATCTTCCTGATGCTAAACAAG
GCACTGAACATCTGAGAGAAATATTTTACCGAATGGGTCTGTCAGACAAGGATATTGTTGCATTATCCGGTGCC
CACACTTTG
GGGAGAGCGCATCAGGAAAGGTCTGGTTTCGAAGGTCCTTGGACAAAGGAACCTCTGAAGTTTGACAATACATACTTTGTGGAACTGCTGGAAGGAGAAAAGAAAGGACTT
TTAAAGCTACCAACGGACAATACTTTACTGCATGATCCTGCATTCCGTGGTTATGTTGAACTGTATGCAAAG
GATGAAGATGCATTTTTTAGGGATTATACCGTATCCCATAAGAAGCTC
TCTGAACTTGGCTGCTTTGCTCCGACATCCAACAAAGCAGATTCAAATGGTTTTTTGGTTCATAGTGCTTTTGGAGTTGCCGTTACTGCTGCTGTGGTGATACTGAGTTACTGTTTTGAG
GTTTCAAGGAAAAAAATGTGA

Retrieve as FASTA