Entry information : SsGPx01_AU1
Entry ID 12576
Creation 2013-11-12 (Qiang Li)
Last sequence changes 2014-01-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-03 (Christophe Dunand)
Peroxidase information: SsGPx01_AU1
Name SsGPx01_AU1
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Zygnemophyceae Zygnemataceae Spirogyra
Organism Spirogyra sp    [TaxId: 3181 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsGPx01_AU1
start..stop
S start..stop
SpraGPx01 277 1.53e-96 2..169 54..221
SmGPx03-2_107 248 7.66e-85 19..169 88..238
SbGPx03 248 1.29e-84 21..169 90..238
SpGPx01 244 1.59e-84 16..169 5..158
Gene structure Fichier Exons


exon

Literature and cross-references SsGPx01_AU1
Literature Looking for Ancestral Class III Peroxidases in Green Lineage
Protein sequence: SsGPx01_AU1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18708.6 Transmb domain:   %s   i13-35o
PI (pH):   %s   9.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLRLFSGKNKASPIDSNGKTLHDFTVQDVDGKDVDLSEYKGKVALVVNVASQCGLTNTNYKELTALYDKYKDQGFVVLAFPSNQFGSQEPGTNQEIKEFACSRYKASFPLFAKIDVNGPN
TAPVYQFLKSQKSSILGESIKWNFSKFLVDKEGRVVERYLPTTSPKSIE

Retrieve as FASTA  
Remarks Complete sequence from genomic. Sequenced by EEP in LRSV.
DNA
Send to BLAST
CDS
Send to BLAST