Entry information : SsGPx02_AU1
Entry ID 12577
Creation 2013-11-12 (Qiang Li)
Last sequence changes 2014-03-25 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-03 (Christophe Dunand)
Peroxidase information: SsGPx02_AU1
Name SsGPx02_AU1
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Zygnemophyceae Zygnemataceae Spirogyra
Organism Spirogyra sp    [TaxId: 3181 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsGPx02_AU1
start..stop
S start..stop
SpraGPx01 271 1.96e-93 1..143 80..222
SsGPx01_AU1 243 2.77e-83 1..142 28..169
CpslGPx01 237 4.92e-80 1..143 89..232
SmGPx03-1_40 233 3.83e-78 1..142 97..238
Gene structure Fichier Exons


exon

Literature and cross-references SsGPx02_AU1
Literature Looking for Ancestral Class III Peroxidases in Green Lineage
Protein sequence: SsGPx02_AU1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197
PWM (Da):   %s   21394.24  
PI (pH):   %s   9.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DIDGKSVDLSTFKGKVALVVNVASQCGLTDSNYKELTALYEKFKDKGFVVLAFPSNQFGAQEPGSNDQIKNFACSRYKATFPLFSKVDVNGPNAAPVYQFLRSQKGGLLGDSIKWNFGKF
LVDKNGNVVERYAPTVNPSAIEVIQPLQNSIPNVKLIGARLHSFPTLLPLLPLFPAPTSPDRSLFPCLSQADIQKLL

Retrieve as FASTA  
Remarks Complete sequence from genomic. Sequenced by EEP in LRSV. short 5' end is missing.
DNA
Send to BLAST
CDS
Send to BLAST