1. Browse the Database
  2. View Redoxidase
Entry information : SsGPx04_AU1
Entry ID 12578
Creation 2013-11-12 (Qiang Li)
Last sequence changes 2014-03-25 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-03 (Christophe Dunand)
Peroxidase information: SsGPx04_AU1
Name SsGPx04_AU1
Class Plant glutathione peroxidase    [Orthogroup: Gpx2004]
Taxonomy Eukaryota Viridiplantae Streptophyta Zygnemophyceae Zygnemataceae Spirogyra
Organism Spirogyra sp    [TaxId: 3181 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsGPx04_AU1
start..stop		 S start..stop
SpraGPx04 313 2.25e-110 19..207 23..207
CpslGPx02 182 1.35e-58 30..205 2..174
CbraGPx01 176 1.61e-55 2..200 9..203
CbraGPx03 174 1.81e-54 27..200 63..235
Gene structure Fichier Exons►


exon

Literature and cross-references SsGPx04_AU1
Literature Looking for Ancestral Class III Peroxidases in Green Lineage
Protein sequence: SsGPx04_AU1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208 (187)
PWM (Da):   %s   22915.05 (20661.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.95 (4.93) Peptide Signal:   %s   cut: 22 range:22-208
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMMLSSFFLALALRAPLDCAATDVEGFYAISAMDIDGNYVSLSKY
SGTVSLVVNVASKCGLTKSNYEQLSQLQNRFGPRGFQVLAFPCNQFNSQEPGMFRSSNEEVKRFAIQSGANYPLFAKLTVNEPMCKDGGLEDCSSSSSQCCSANNSIYTYLKSAFKGDIDWNFAKFLIGRDGQVLQRYR
AQTYPLSIANDIEMALDKDYPFTV*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Sequenced by EEP in LRSV.
DNA ►
Send to BLAST
CDS►
Send to BLAST