1. Browse the Database
  2. View Redoxidase
Entry information : SsPrx03_AU1
Entry ID 12583
Creation 2013-11-12 (Qiang Li)
Last sequence changes 2014-01-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-03 (Christophe Dunand)
Peroxidase information: SsPrx03_AU1
Name SsPrx03_AU1
Class Class III peroxidase     [Orthogroup: Prx155]*
Taxonomy Eukaryota Viridiplantae Streptophyta Zygnemophyceae Zygnemataceae Spirogyra
Organism Spirogyra sp    [TaxId: 3181 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsPrx03_AU1
start..stop		 S start..stop
SpraPrx02 419 1.04e-147 43..334 57..348
SpraPrx01 262 2.41e-86 43..334 38..326
SsPrx06_AU1 244 8.4e-80 45..334 37..316
SsPrx07_AU1 211 6.46e-67 43..327 35..311
Gene structure Fichier Exons►


exon

Literature and cross-references SsPrx03_AU1
Literature Looking for Ancestral Class III Peroxidases in Green Lineage
Protein sequence: SsPrx03_AU1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (298)
PWM (Da):   %s   37235.35 (31508.4) Transmb domain:   %s   i9-31o
PI (pH):   %s   10.11 (6.74) Peptide Signal:   %s   cut: 25 range:25-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSESKPSYFLALRTLDTQHHSKILRNRDTRLWKNHFVQDRMKACPQLENLVNRAFEAQWKKDRSVSPAILRLFFHDALVNGVDGSILLNGTGTNLAEKDNPDVKHLRGFDALERVKATVEASCPRKISCADTLTLMTKFAVIKSGGPEIDFNLGRLDGFSS
NLELAKLLTPRHFSTATALLNIFFLLGLSQVDLVALSGAHTIGVAHCESVRTRIYPTIDTKYEPQFGISVRKSCPIVDPSQNPPLLDPNATLKLDQTSTVFDNSYFQGLRSNRGLMTSDN
NLNADPRLNSQVAKFASNQSAFFNQFRLSMKKLSEINLRSVGNVRRKCYKLN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Sequenced by EEP in LRSV. Containing motif fhda. Missing 'c'. Containing IntR (5'). Containing IntR (3').
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST