Entry information : BaLiP07
Entry ID 12586
Creation 2013-11-20 (Christophe Dunand)
Last sequence changes 2013-11-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-11-20 (Christophe Dunand)
Peroxidase information: BaLiP07
Name BaLiP07
Class Lignin peroxidase    [Orthogroup: LiP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaLiP07
start..stop
S start..stop
BaLiP03_IFO5307 702 0 1..371 1..372
BaLiP03 701 0 1..371 1..372
BaLiP12 669 0 1..361 1..362
BaLiP05 645 0 1..371 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106926..107129 204 N° 2 106819..106871 53 N° 3 106552..106766 215 N° 4 105953..106497 545
N° 5 105828..105892 65 N° 6 105739..105772 34  
complement(join(105739..105772,105828..105892,105953..106497,106552..106766,1068 19..106871,106926..107129))


exon

Literature and cross-references BaLiP07
DNA ref. JGI genome:   scaffold_19 (107130..105739)
Protein sequence: BaLiP07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (353)
PWM (Da):   %s   39473.65 (37617.6)  
PI (pH):   %s   4.65 (4.58) Peptide Signal:   %s   cut: 19 range:19-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLLATLSAVLVAQAAITKRVACPDGKNTAVNAACCSLFTARDDIQKNMFDGGQCNDIAHQAIRLTFHDAVAFSPALAQGKFGGNGADGSIMTFDTIETAFHPNIGLDEIVNIEKPFAKFHNMTPGDFIHFAGAIAVTNCAGAPTLSFSIGRPPVAPAPDGLVPEPFHTNDQIFARMLDALEFDDLETVWGLIAHTVGASDDVDPTIPRTPFDSTPSLFDGQFFIDTQLRGVLFPGKVGIQGEVQSPLKGQIRLQSDHLIARDSRSACEWQSFADDHDKLTNRFQFVIETLAMVGQDPTNMIDCSEVIPIPKDLTLAQLTPMFPAGKTHADVEQCADTAFPNFATRPGPAIAVPPVPSAKTGAPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). Incorrect prediction from JGI. FHD is missing due to frame shift (extra c) and bad prediction of intron 1.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCCTCGCTACCCTCTCCGCCGTCCTTGTGGCGCAGGCAGCGATCACAAAGCGCGTCGCCTGCCCCGATGGCAAGAACACTGCCGTCAACGCTGCATGCTGCAGC
TTGTTCACTGCCCGCGACGACATTCAGAAGAACATGTTCGACGGCGGCCAGTGCAACGACATTGCTCACCAGGCTATCCGACTG
TGAGCTCCACTCAGATTTACGACAGCGGCGCATCGA
TGCTAACTGTGCTGCAGGACCTTCCACGACGCCGTCGCGTTCTCCCCAGCTCTCGCCCAGGGCAAGTTCGGGTACGTGCCAACATATCATGATTATCTGCAGCATTCTAACCTTTACTTG
CAGTGGCAATGGCGCTGATGGGTCTATCATGACCTTCGACACCATCGAGACCGCCTTCCACCCCAACATCGGTCTCGACGAGATCGTCAACATCGAGAAGCCGTTCGCCAAGTTCCACAA
CATGACCCCCGGCGACTTCATCCACTTTGCAGGTGCCATCGCTGTCACGAACTGCGCCGGCGCGCCCACTCTAAGCTTCTCCATTGGTCGCCCCCCAC
GTACGCGATGATCCGCACCCAC
ATGCTGAATATACTGACGTCTGCTCTTCTCAGCGGTTGCCCCCGCCCCCGACGGTCTCGTCCCCGAGCCGTTCCACACCAACGACCAGATCTTCGCCCGCATGCTCGACGCACTCGAGTT
TGACGACCTCGAGACCGTCTGGGGTCTCATCGCGCACACCGTCGGTGCCTCCGACGACGTCGACCCGACGATCCCGCGCACGCCCTTTGACTCGACGCCCTCGCTCTTCGACGGCCAATT
TTTCATCGACACGCAGCTCCGCGGCGTCCTGTTCCCCGGCAAAGTCGGCATCCAGGGCGAGGTGCAATCTCCGCTCAAGGGCCAGATTCGCCTCCAGTCCGACCACCTCATCGCGCGCGA
CTCTCGCTCTGCTTGCGAGTGGCAGTCCTTCGCCGACGACCACGACAAGCTTACCAACCGATTCCAGTTCGTCATCGAGACCCTCGCGATGGTTGGCCAGGACCCGACCAACATGATCGA
CTGCTCAGAGGTTATCCCTATCCCCAAGGACCTGACCCTCGCCCAGCTCACCCCCATGTTCCCCGCTGGCAAGACCCACGCCGACGTCGAGCAGGCT
GTATGTACCCCATGATTCGCTCC
TCACTGTGGCACAGAACGCTGATGACGAGTCCCATAGTGCGCCGACACCGCCTTCCCGAACTTTGCAACCCGCCCCGGCCCTGCTATCGCTGTTCCTCCTGTGTACGTCTCTTTTCTAGC
CCTTTGAGATACTGAATCTGACAGTCCCTTTCCACAGCCCCTCCGCAAAGACTGGAGCTCCCGGATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCCTCGCTACCCTCTCCGCCGTCCTTGTGGCGCAGGCAGCGATCACAAAGCGCGTCGCCTGCCCCGATGGCAAGAACACTGCCGTCAACGCTGCATGCTGCAGC
TTGTTCACTGCCCGCGACGACATTCAGAAGAACATGTTCGACGGCGGCCAGTGCAACGACATTGCTCACCAGGCTATCCGACTG
ACCTTCCACGACGCCGTCGCGTTCTCCCCAGCTCTC
GCCCAGGGCAAGTTCGG
TGGCAATGGCGCTGATGGGTCTATCATGACCTTCGACACCATCGAGACCGCCTTCCACCCCAACATCGGTCTCGACGAGATCGTCAACATCGAGAAGCCGTTC
GCCAAGTTCCACAACATGACCCCCGGCGACTTCATCCACTTTGCAGGTGCCATCGCTGTCACGAACTGCGCCGGCGCGCCCACTCTAAGCTTCTCCATTGGTCGCCCCCCAC
CGGTTGCC
CCCGCCCCCGACGGTCTCGTCCCCGAGCCGTTCCACACCAACGACCAGATCTTCGCCCGCATGCTCGACGCACTCGAGTTTGACGACCTCGAGACCGTCTGGGGTCTCATCGCGCACACC
GTCGGTGCCTCCGACGACGTCGACCCGACGATCCCGCGCACGCCCTTTGACTCGACGCCCTCGCTCTTCGACGGCCAATTTTTCATCGACACGCAGCTCCGCGGCGTCCTGTTCCCCGGC
AAAGTCGGCATCCAGGGCGAGGTGCAATCTCCGCTCAAGGGCCAGATTCGCCTCCAGTCCGACCACCTCATCGCGCGCGACTCTCGCTCTGCTTGCGAGTGGCAGTCCTTCGCCGACGAC
CACGACAAGCTTACCAACCGATTCCAGTTCGTCATCGAGACCCTCGCGATGGTTGGCCAGGACCCGACCAACATGATCGACTGCTCAGAGGTTATCCCTATCCCCAAGGACCTGACCCTC
GCCCAGCTCACCCCCATGTTCCCCGCTGGCAAGACCCACGCCGACGTCGAGCAGGCT
TGCGCCGACACCGCCTTCCCGAACTTTGCAACCCGCCCCGGCCCTGCTATCGCTGTTCCTCCT
GT
CCCCTCCGCAAAGACTGGAGCTCCCGGATCTTAA

Retrieve as FASTA