Entry information : SlutGPx01
Entry ID 12600
Creation 2013-12-16 (Christophe Dunand)
Last sequence changes 2016-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: SlutGPx01
Name SlutGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Suillaceae Suillus
Organism Suillus luteus    [TaxId: 5384 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SlutGPx01
start..stop
S start..stop
SbreGPx01 343 1.14e-123 1..167 1..167
HpinGPx01 296 4.51e-105 4..165 2..163
XbadGPx01 295 3.16e-104 3..166 2..165
GliviGPx01 293 1.17e-103 4..164 2..162
Gene structure Fichier Exons


exon

Literature and cross-references SlutGPx01
Cluster/Prediction ref. JGI gene:   22575
Protein sequence: SlutGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18557.35  
PI (pH):   %s   8.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSSETNFYGLKTELPSGQTYDFEQLKGKVVLIVNVASKCGFTPQYKGLQALYDKYKERDFVILGFPCNQFGGQEPGDDAAIASFCELNHGVNFPLMKKSDVNGDNTNPVYQWLKNEKP
GLMGLSRIKWNFEKFLIDKNGKVVNRWASTTTPQAIDAVVEKLLAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
CDS
Send to BLAST