Entry information : PabPrx186(PAB00050395 / MA_66201g0010)
| Entry ID | 12716 |
|---|---|
| Creation | 2013-12-19 (Qiang Li) |
| Last sequence changes | 2013-12-19 (Christophe Dunand) |
| Sequence status | partial |
| Reviewer | Not yet reviewed |
| Last annotation changes | 2021-04-28 (Christophe Dunand) |
Peroxidase information: PabPrx186(PAB00050395 / MA_66201g0010)
| Name | PabPrx186(PAB00050395 / MA_66201g0010) | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Class III peroxidase [Orthogroup: Prx007]* | |||||||||||||||||||||||||||||||||||||||||||||
| Taxonomy | Eukaryota Viridiplantae Streptophyta Pinaceae Picea | |||||||||||||||||||||||||||||||||||||||||||||
| Organism | Picea abies (Norway spruce) [TaxId: 3329 ] | |||||||||||||||||||||||||||||||||||||||||||||
| Cellular localisation | N/D |
|||||||||||||||||||||||||||||||||||||||||||||
| Tissue type | N/D |
|||||||||||||||||||||||||||||||||||||||||||||
| Inducer | N/D |
|||||||||||||||||||||||||||||||||||||||||||||
| Repressor | N/D |
|||||||||||||||||||||||||||||||||||||||||||||
| Best BLASTp hits |
|
Literature and cross-references PabPrx186(PAB00050395 / MA_66201g0010)
Protein sequence: PabPrx186(PAB00050395 / MA_66201g0010)
| Sequence Properties first value : protein second value (mature protein) |
|
||||||||||||
| Sequence Send to BLAST Send to Peroxiscan |
|
||||||||||||
| Remarks | Partial sequence from genomic. Incorrect prediction (start of exon 4 is missing due to NN in the seq). Contain another exon 4 downstream (IIHITGAHTIGQARCLLFRASIYNESNINAAFATSAKAKCPSAGSDNNLSPLDVATPTTFDNYYYINLGSEKGLLHSDQQLFTGGSTDS*VTVYSSNQNTFFPDFKAAMMNMGNIKPLTGTSGEICKNGRNPN) | ||||||||||||
| DNA ► Send to BLAST |
|
||||||||||||
