Entry information : PabPrx186(PAB00050395 / MA_66201g0010)
Entry ID 12716
Creation 2013-12-19 (Qiang Li)
Last sequence changes 2013-12-19 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2021-04-28 (Christophe Dunand)
Peroxidase information: PabPrx186(PAB00050395 / MA_66201g0010)
Name PabPrx186(PAB00050395 / MA_66201g0010)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Pinaceae Picea
Organism Picea abies (Norway spruce)    [TaxId: 3329 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PabPrx186
S start..stop
PtaPrx134 378 2e-132 1..203 1..203
PtaPrx134 108 1e-27 215..283 285..353
PabPrx303 352 3e-122 1..203 1..203
PabPrx303 93 4e-22 215..283 285..353
PtaPrx135 345 2e-119 1..203 1..203
PtaPrx135 91 2e-21 215..283 285..351
PtaPrx42 340 9e-118 1..203 3..205
PtaPrx42 91 4e-21 215..283 287..353
Literature and cross-references PabPrx186(PAB00050395 / MA_66201g0010)
Protein sequence: PabPrx186(PAB00050395 / MA_66201g0010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283 (260)
PWM (Da):   %s   29264.3 (27980.7)  
PI (pH):   %s   8.2 (8.37) Peptide Signal:   %s   cut: 19 range:19-278
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction (start of exon 4 is missing due to NN in the seq). Contain another exon 4 downstream (IIHITGAHTIGQARCLLFRASIYNESNINAAFATSAKAKCPSAGSDNNLSPLDVATPTTFDNYYYINLGSEKGLLHSDQQLFTGGSTDS*VTVYSSNQNTFFPDFKAAMMNMGNIKPLTGTSGEICKNGRNPN)
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2

Retrieve as FASTA