Entry information : PabPrx186(PAB00050395 / MA_66201g0010)
Entry ID 12716
Creation 2013-12-19 (Qiang Li)
Last sequence changes 2013-12-19 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2021-04-28 (Christophe Dunand)
Peroxidase information: PabPrx186(PAB00050395 / MA_66201g0010)
Name PabPrx186(PAB00050395 / MA_66201g0010)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Pinaceae Picea
Organism Picea abies (Norway spruce)    [TaxId: 3329 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PabPrx186
start..stop
S start..stop
PtaPrx134 378 2e-132 1..203 1..203
PtaPrx134 108 1e-27 215..283 285..353
PabPrx303 352 3e-122 1..203 1..203
PabPrx303 93 3e-22 215..283 285..353
PtaPrx135 345 2e-119 1..203 1..203
PtaPrx135 91 2e-21 215..283 285..351
PtaPrx42 340 9e-118 1..203 3..205
PtaPrx42 91 4e-21 215..283 287..353
Literature and cross-references PabPrx186(PAB00050395 / MA_66201g0010)
Protein sequence: PabPrx186(PAB00050395 / MA_66201g0010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283 (260)
PWM (Da):   %s   29264.3 (27980.7)  
PI (pH):   %s   8.2 (8.37) Peptide Signal:   %s   cut: 19 range:19-278
Sequence
Send to BLAST
Send to Peroxiscan
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
MEKVAIFCLI CTLGIAYARV DDILTLNREP PLVNGLSWKF YEKSCPTLES VVRKRINFYL KKDITQAAGL LRLHFHDCFV QGCDGSVLLD GSASGPSEQD APPNLTLRAK AFEIINDIKS  RVEKACKGVV SCADLTALAA RESVRAAGGP EYRVPLGRRD SLKFATRAVT VANLPSPLSN ASTLIKAFAS KKLDVTDLVS LSGxxxxxxx xxxxTREIVK QFAADQDLFF EKFAFAIAKM 
GQLNVLTGSK GEIRSSCSAR NSASIVEVAV EDVVDAESSV AFM 

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction (start of exon 4 is missing due to NN in the seq). Contain another exon 4 downstream (IIHITGAHTIGQARCLLFRASIYNESNINAAFATSAKAKCPSAGSDNNLSPLDVATPTTFDNYYYINLGSEKGLLHSDQQLFTGGSTDS*VTVYSSNQNTFFPDFKAAMMNMGNIKPLTGTSGEICKNGRNPN)
DNA
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
ATGGAGAAGG TTGCAATCTT TTGTTTGATA TGCACACTCG GGATCGCTTA TGCCAGAGTA GATGATATTC TAACTTTGAA TCGGGAACCG CCCCTCGTTA ATGGACTGTC ATGGAAATTT  TACGAGAAGA GCTGCCCTAC GCTGGAATCT GTTGTAAGAA AAAGGATCAA CTTCTACTTA AAGAAGGACA TCACCCAAGC GGCTGGGTTG CTACGCCTCC ACTTCCATGA CTGCTTCGTT  CAGGTACTTG TTTATACATA TCCCACTCCG TAGAATTCGA ACCTGTAACC TCTAAGTCTA TGCTTCAAAG CATATAACTT CATTTACAGG ACATCACCCA AGCGGCTGGG TTGCTACGCC  TCCACTTCCA TGACTGCTTC GTTCAGGTAC TTGTTTATAC ATATCCCACT CCGTAGAATT CGAACCTGTA ACCTGTAAGT CTATGCTTCA AAGCATATAA CTTCATTTAC ATCTACAGGG  TTGCGACGGA TCGGTTCTGC TGGACGGTTC TGCAAGCGGT CCTAGCGAAC AGGACGCTCC ACCCAACTTA ACGCTGAGAG CGAAAGCCTT TGAAATAATA AACGACATCA AGAGCCGGGT  GGAAAAGGCT TGCAAGGGCG TCGTCTCTTG CGCAGACTTG ACTGCCCTCG CAGCTCGCGA GTCGGTTAGG GCGGTAAGCC ACCATAATTC TCTTCTATTT CATTATGTTG TAGTCTATTT  TGGGTCAATT CGATCAGTTT GTTTAAGATT AAGATTCGCT CTGTGATTAG GCTGGAGGGC CAGAGTATCG AGTGCCTCTG GGGCGCAGGG ACAGCCTGAA ATTCGCCACA CGAGCCGTGA  CCGTTGCCAA CCTCCCGTCT CCGCTCTCTA ATGCCAGCAC CCTCATCAAG GCTTTCGCCT CCAAGAAGCT GGACGTCACA GACCTGGTTT CTCTTTCAGG TTTTGCTATC GTTCTTTTAG  TGACTAAGAA CTGCTCTAAA TTTTGGAATC TCATTTTTGT AATGATCnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnCT CTCAGACCCG AGAAATCGTC  AAACAATTCG CTGCCGACCA GGATCTTTTC TTCGAGAAAT TTGCTTTTGC CATAGCGAAG ATGGGCCAAC TGAACGTCCT GACGGGATCG AAAGGGGAGA TCAGGAGCAG CTGTTCTGCT 
CGCAATTCTG CTTCTATCGT CGAAGTCGCT GTAGAGGATG TCGTAGATGC CGAATCTTCT GTGGCCTTCA TGTGA 

Retrieve as FASTA