Entry information : PabPrx186(PAB00050395 / MA_66201g0010)
Entry ID 12716
Creation 2013-12-19 (Qiang Li)
Last sequence changes 2013-12-19 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2021-04-28 (Christophe Dunand)
Peroxidase information: PabPrx186(PAB00050395 / MA_66201g0010)
Name PabPrx186(PAB00050395 / MA_66201g0010)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Pinaceae Picea
Organism Picea abies (Norway spruce)    [TaxId: 3329 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PabPrx186
S start..stop
PtaPrx134 378 2.54e-132 1..203 1..203
PtaPrx134 108 1.32e-27 215..283 285..353
PabPrx303 352 3.55e-122 1..203 1..203
PabPrx303 93 3.81e-22 215..283 285..353
PtaPrx135 345 2.13e-119 1..203 1..203
PtaPrx135 91 1.89e-21 215..283 285..351
PtaPrx42 340 9.73e-118 1..203 3..205
PtaPrx42 91 3.97e-21 215..283 287..353
Literature and cross-references PabPrx186(PAB00050395 / MA_66201g0010)
Protein sequence: PabPrx186(PAB00050395 / MA_66201g0010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283 (265)
PWM (Da):   %s   29264.3 (27324.3)  
PI (pH):   %s   8.2 (8.37) Peptide Signal:   %s   cut: 19 range:19-283
Send to BLAST
Send to Peroxiscan
*.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction (start of exon 4 is missing due to NN in the seq). Contain another exon 4 downstream (IIHITGAHTIGQARCLLFRASIYNESNINAAFATSAKAKCPSAGSDNNLSPLDVATPTTFDNYYYINLGSEKGLLHSDQQLFTGGSTDS*VTVYSSNQNTFFPDFKAAMMNMGNIKPLTGTSGEICKNGRNPN)
Send to BLAST
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2

Retrieve as FASTA