Entry information : KflPrx02 (kfl00035_0330)
Entry ID 12840
Creation 2013-12-31 (Christophe Dunand)
Last sequence changes 2014-08-20 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-09-02 (Qiang Li)
Peroxidase information: KflPrx02 (kfl00035_0330)
Name (synonym) KflPrx02 (kfl00035_0330)
Class Class III peroxidase    [Orthogroup: Prx275]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrx02
start..stop
S start..stop
KflPrx01 277 3e-92 27..269 23..263
CsaPrx01 134 3e-37 65..306 36..288
PabPrx302 132 3e-36 57..265 35..256
PtaPrx145 127 2e-34 57..265 29..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..81 81 N° 2 389..491 103 N° 3 719..814 96 N° 4 1144..1214 71
N° 5 1472..1534 63 N° 6 1762..1881 120 N° 7 2055..2109 55 N° 8 2571..2649 79
N° 9 2990..3302 313  
join(1..81,389..491,719..814,1144..1214,1472..1534,1762..1881,2055..2109,2571..2 649,2990..3302)


exon

Literature and cross-references KflPrx02 (kfl00035_0330)
Cluster/Prediction ref. klebsormidium DB:   kfl00035_0330
Protein sequence: KflPrx02 (kfl00035_0330)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (296)
PWM (Da):   %s   35773.56 (32627.9) Transmb domain:   %s   i7-29o303-322i (o273-292i)
PI (pH):   %s   5.91 (5.64) Peptide Signal:   %s   cut: 31 range:31-326
Sequence 367
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTNTWVCSALGLLLATLSLLCLLTTQVTGAELTHEQLFKFAPLPDGALPDEHVYTPGVRECIFQIIRKNLLTMSLKDERINAKFLRLIFHDCAAGGCNGSIMRTEEHNGTANEFLTGFDEVRMVKAAIDTSCNVSISLADTIIAGGVEGVKETGGPDITAYVRFGRRDTDDRDDPNKLPLPFVSTDELVRVFAPLGLNVEDLVALSGAHTIGKATCKNIVARLGTDPTADPAFLFSLLPRCTALATQQLDLDAKTPEVFDKYYFQVRHANLLEWTLGPMALEGCRACSVRSSLRLLHPLFEIFWRPSLLFSATLLTLFVLLPRRA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect predict from KDB (very long 3'end). The prediction of the 3' need to be confirmed.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGACAAACACCTGGGTTTGCTCAGCTTTGGGGCTGCTGCTCGCAACCCTCAGTCTTCTATGTCTTTTGACCACTCAGGTTCGTTTCTCTCTGACACTGCTGAAGGACTTAATATGAA
TGAGGTGACAGTAATAATCGAATCACACAAAGCTCATGATGGATACAGCAGCTGCATGAATCGACCTCCATGACTGATTATCGTTTTCGGCGAAGGTCATGGATAGGCCCAAAACATCAT
CTTCCTCTTTCAAGTGCTCTCTCCAATCAAAAGCTCTGCCTCCGATTGTGGCTAGATGTGTTGCTTCAATATACGCCGACAACGGATGCCTCCAGCTGCAAAGCTGAGCGTGATGCTGCA
AAATACCATTACACCCTCTGAGTGCAGGTGACTGGAGCAGAGTTGACACATGAGCAGCTGTTCAAGTTTGCTCCATTGCCCGATGGGGCGCTCCCCGATGAGCACGTTTACACACCAGGC
GTCCGAGAAT
GTGAGTGCAAAGAATCGAATCCGATTGAGCCACACTGTCTGCTAGGCAGAAGGTATCACTTTCAAGCTGGCTTGAAACTGGTAATTGACGTCCTGGTCAAAACCCTGAAC
GACTTGGAGGGGGTTACATGGTACCTAGTGATTGATACTAGGGTCGTATCATCTTTCTCCAGGAAAAAATATAGCTCAAGGCATGCTAAAACAGGGGTCTAATGCTGTCCTGTGCAGGCA
TCTTCCAGATCATCCGGAAGAACTTACTGACCATGTCCCTCAAAGATGAGCGCATCAATGCCAAGTTCTTGCGGCTGATATTCCACGACTGCG
GTAAGCGCGATTTTATCTGGTGAGCAT
TTAATTGATTCCAATGAAATCGTTGTGAATGGGTTCTGGAATGTGTCCTATCAATCAATTCCGGTGAAGGACCTGCAAATCTTTTGTAGAGTTTTCAGCTCCCCTGATCTGGTTGCCTGT
TAACTCTGCCAACCTTTCCAACGAAAAGATACCCGTTTAGGGACGGATTACCAGAGTCTGTGTGGTCCACAGCTTATGTATAAGTTTGCATAATCCTCATCAATAAGCAACAGCTTATGT
ACCCAGATCTGTCTGGCCAAACGGGCGCTTATGCATAATTGACTTATCGCTGATATGCGCAGCTGCTGGCGGCTGCAACGGGTCCATCATGCGGACAGAGGAGCACAATGGAACGGCAAA
CGAGTTTCTTACT
GTAAGTTGTCGTCCTCTTTTTCTTTCGACTGTTTGGTGCTGTTCAGCTTTCGAAAACATGTGGACACGATCTTGCCATTACTTCTGAATGCAGAGCACTTTGACAAC
CCTTTTTTATTGTTGGAAAGGTATGTGTATGTGACTTTCCAAAAGGTTGACGTTTCAGGAGAGCGAAGCTGCCTGACTGAGTATGATCCACTTCGAATGCCTCAAACAACAATGAAACGA
CCTTCTGACGTGCAATTTTCGAATCCGCAGGGGTTTGACGAGGTCCGTATGGTCAAAGCTGCAATTGATACCTCGTGCAACGTCAGCATCTCGGTGAGGCTTCCTTTACAAAGCTATGTT
GCCACTGATCATTCTTGTATCGAGGATCAAGGTTACCCTCGATCGCTTTTGTCAATACACTTTGTCTACGGCTTGACAAGATTTTTGCATACTATCAACATCGCTCACGCTAGTTCTGGA
TCTCTGGCAACGGGGTTGTCTTTGGAATTATCTCTGAGCAGCAAGCTCAAGCTCTCATCCAAAGTGTGCGTCCCTTGCAGCTTGCTGATACGATCATTGCTGGGGGAGTGGAAGGAGTGA
AGGAGACGGGTGGCCCTGACATCACGGCCTACGTCAGGTTCGGCAGGCGGGATACAGACGACCGAGACGATCCCAACAAA
GTGAGAAGTCCTGGAATTTCCGTCAGCATCGCAGCACTTT
TCAGGCAGATGTTTAAAGGGTTCTACTCGGGTTGGAATACTGCTCTGTTTTGGGTCGATCCGGCGATAAAAGATTATGTGCTTGGGCCGAATCATGGCTGTAAGGATGCTGACTTTCTTC
ACCCTCTCTGCAGCTGCCGCTTCCGTTCGTCTCGACGGACGAGCTGGTCAGAGTTTTCGCTCCTCTCGGTAAGCCACGCTTGTCTTCAAGCCGACTCAACCAGTTTGGCGTTACTTCTTC
CCGTTCAATGCATTAGCGAGCTTCCGTTTCTCACTGTAACGCTGGGCCACCAGACTGAGGGCAATCAGATGTTAGCAATCACAAGCAACGGAGGCTGTCGCATGCTGTCGGAGGCTGCCG
GAGTCGAGTTAGTTGATATGACAATTGAGGGTCTTCTTAGCTGGTGGCTCGTAAAACTTCTTTCAGTTGAACAGCTTTCGACTATAGATGGTTCAGGAGCTCGAAACGAACTATGAGAAG
CTTTCCGAATCTACCGAGGAACAAAGCGCTGGTCGAGAACCTGCAGACGCCTGAGAATATTGAAAGTCCTACTGCTTTGTGTCCTAAAAAGCTCTCCTTTGCTACTTGAATCAAGCTCCC
TCAAACCCTGTGAGAGACTTGAGAGGTGAAGTACGCGCTGTCAGTGCAGGGCTCAACGTGGAGGACCTTGTGGCGCTTTCTGGGGCCCATACCATCGGCAAAGCCACGTGCAAGAACATC
GTCGCCAG
GTAGGGCAGCGTCACCGGCGCCCAATCAAATACCATTTGTCTTTGAGAACACTAACATGCTGCGACGGTGTCGACACGTCACTTGATTGCGAGGTGTTTCGGAGACTGCCGG
AGGGAACGATTGGGAGATCCGTATGACATCTTGCGGATCCATTATCGTTCTCCAATTAAGCAACACAAGAACCTGCTGATCTGCCCTGTCTTTGTCAATGGTTGCAGCATATATCAATGA
AGGCACCATTATATGAAAGACCATAGACCTCTTCTACTGAAGGAAGTGAAGAGGAAAATGGTTCGAGACTTTCTTTCTCTCAAGGGTGTCTTCCTGGAACTTATGCAGGCTGGGAACCGA
TCCAACAGCCGACCCCGCTTTCCTGTTCAGCCTTCTGCCTAGATGCACAGCCCTGGCCACGCAGCAGCTCGATCTGGACGCCAAAACCCCTGAGGTCTTCGACAAGTACTACTTCCAGGT
GAGACATGCGAATCTGCTCGAATGGACGCTCGGACCGATGGCACTGGAAGGTTGTAGAGCATGCAGTGTGAGGTCGTCTCTTCGACTTCTCCATCCGCTCTTTGAAATATTCTGGCGTCC
CTCTCTTCTGTTCTCCGCGACTTTGCTCACGCTGTTCGTTCTCTTGCCGCGCAGGGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGACAAACACCTGGGTTTGCTCAGCTTTGGGGCTGCTGCTCGCAACCCTCAGTCTTCTATGTCTTTTGACCACTCAGGTGACTGGAGCAGAGTTGACACATGAGCAGCTGTTCAAGT
TTGCTCCATTGCCCGATGGGGCGCTCCCCGATGAGCACGTTTACACACCAGGCGTCCGAGAAT
GCATCTTCCAGATCATCCGGAAGAACTTACTGACCATGTCCCTCAAAGATGAGCGCA
TCAATGCCAAGTTCTTGCGGCTGATATTCCACGACTGCG
CTGCTGGCGGCTGCAACGGGTCCATCATGCGGACAGAGGAGCACAATGGAACGGCAAACGAGTTTCTTACTGGGTTTGACG
AGGTCCGTATGGTCAAAGCTGCAATTGATACCTCGTGCAACGTCAGCATCTCG
CTTGCTGATACGATCATTGCTGGGGGAGTGGAAGGAGTGAAGGAGACGGGTGGCCCTGACATCACGG
CCTACGTCAGGTTCGGCAGGCGGGATACAGACGACCGAGACGATCCCAACAAA
CTGCCGCTTCCGTTCGTCTCGACGGACGAGCTGGTCAGAGTTTTCGCTCCTCTCGGGCTCAACGTGG
AGGACCTTGTGGCGCTTTCTGGGGCCCATACCATCGGCAAAGCCACGTGCAAGAACATCGTCGCCAG
GCTGGGAACCGATCCAACAGCCGACCCCGCTTTCCTGTTCAGCCTTCTGCCTA
GATGCACAGCCCTGGCCACGCAGCAGCTCGATCTGGACGCCAAAACCCCTGAGGTCTTCGACAAGTACTACTTCCAGGTGAGACATGCGAATCTGCTCGAATGGACGCTCGGACCGATGG
CACTGGAAGGTTGTAGAGCATGCAGTGTGAGGTCGTCTCTTCGACTTCTCCATCCGCTCTTTGAAATATTCTGGCGTCCCTCTCTTCTGTTCTCCGCGACTTTGCTCACGCTGTTCGTTC
TCTTGCCGCGCAGGGCCTGA

Retrieve as FASTA