Entry information : Sdic2CysPrx02 (SDRG_04285T0)
Entry ID 12861
Creation 2014-02-26 (Christophe Dunand)
Last sequence changes 2014-02-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-17 (Christophe Dunand)
Peroxidase information: Sdic2CysPrx02 (SDRG_04285T0)
Name (synonym) Sdic2CysPrx02 (SDRG_04285T0)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Saprolegniaceae Saprolegnia
Organism Saprolegnia diclina    [TaxId: 112098 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sdic2CysPrx02
start..stop
S start..stop
Aeu2CysPrx02_201684 356 9.19e-126 62..262 46..246
Gga2CysPrx03 250 1.91e-83 66..261 97..285
Xl2CysPrx03-1 248 4.03e-83 40..261 35..251
Xl2CysPrx03-2 248 7.43e-83 28..261 25..251
Gene structure Fichier Exons


exon

Literature and cross-references Sdic2CysPrx02 (SDRG_04285T0)
DNA ref. GenBank:   JH767141.1 (770017..770924)
Protein sequence: Sdic2CysPrx02 (SDRG_04285T0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267 (245)
PWM (Da):   %s   29556.35 (27179.0)  
PI (pH):   %s   8.23 (7.21) Peptide Signal:   %s   cut: 23 range:23-267
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSLRTLLKMTLLLAALVAIHGLKEKTKSVGGLVPEIGLTEAQLAKLGYVKKNQHSSTSFVTPRKHAPQFHDVKSVVNEKFTTVSLDDYKGKWLVLFFYPFDFTFVCPTEIVSFSDSIKSFRSINAEVLAISTDSHHTHLAWIKTPRE
KGGLGKMNIPILADISKRISSDYGVLVTDEDDEMFGAALRGLFIIDPKGVVRSIQINDDQVGRSVDETLRILKAFSYADSHPGEVCPANWTPGSKTIKADQEAKYAFFEATYGNEKEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
CDS
Send to BLAST