Entry information : SdicPrxQ
Entry ID 12888
Creation 2014-03-17 (Christophe Dunand)
Last sequence changes 2014-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-17 (Christophe Dunand)
Peroxidase information: SdicPrxQ
Name SdicPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Saprolegniaceae Saprolegnia
Organism Saprolegnia diclina    [TaxId: 112098 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SdicPrxQ
start..stop
S start..stop
SparPrxQ 337 6.68e-120 1..195 1..194
AeuPrxQ01_201684 187 7.73e-60 1..190 1..258
PsojPrxQ 173 2.21e-53 19..192 16..190
PsojPrxQ 154 8.92e-46 25..195 197..363
PparaPrxQ_P1569 163 1.47e-49 21..197 19..195
PparaPrxQ_P1569 153 1.82e-45 23..193 190..361
Gene structure Fichier Exons


exon

Literature and cross-references SdicPrxQ
DNA ref. GenBank:   JH767165.1 (225394..226033)
Protein sequence: SdicPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197 (339)
PWM (Da):   %s   21162.07 (36076.8)  
PI (pH):   %s   10.34 (6.50) Peptide Signal:   %s   cut: 26 range:26-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTETRRSKRLANTEPDVVAAPAKKARKAAPAKKADPKKGSSSPKVPSLKVGDTIVDVELKNEKDEPVSVLELTKEMGAVFFMFPKANTPGCTKQACGFRDHHDAFKAAGYNVFALAQDNP
TPLTTWQKGQKLPYTLLSDKAHALIQQFGSSKDGKKKVQRSHVVVAKGGVIADMQPQVSPQESVDKALAFCKASASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
CDS
Send to BLAST