Entry information : GrPrx32 ( Gorai.010G131800)
Entry ID 12890
Creation 2014-03-17 (Maxime Neel)
Last sequence changes 2014-03-17 (Maxime Neel)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-16 (Christophe Dunand)
Peroxidase information: GrPrx32 ( Gorai.010G131800)
Name (synonym) GrPrx32 ( Gorai.010G131800)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Malvaceae Gossypium
Organism Gossypium raimondii    [TaxId: 29730 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GrPrx32
start..stop
S start..stop
PtPrx67 576 0 4..348 5..352
GrPrx33 572 0 1..343 15..361
GhPrx33 571 0 1..343 15..361
FvPrx01 544 0 10..347 12..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28982021..28982266 246 N° 2 28982550..28982738 189 N° 3 28984554..28985168 615  
join(28982021..28982266,28982550..28982738,28984554..28985168)


exon

Literature and cross-references GrPrx32 ( Gorai.010G131800)
DNA ref. Phytozome 12:   chr10 (28982021..28985381)
EST ref. GenBank:   CO087369.1
Protein sequence: GrPrx32 ( Gorai.010G131800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (322)
PWM (Da):   %s   37879.08 (34825.5)  
PI (pH):   %s   8.39 (8.20) Peptide Signal:   %s   cut: 28 range:28-349
Sequence 391
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKATSFTAFLLMSSLFLSSHFSVSKADNSAPIVSGLSWTFYKTSCPKVESIIRKQLQKVFKKDIGQAAGLLRLHFHDCFVQGCDASVLLDGSASGPSEQDAPPNLTLRGFEIINDLRARVHKECGRVVSCADIAALAARDSVYLSGGPDYDVPLGRRDGLSFATRNATLQNLPAPFANATAILSSLATKNFDPTDVVALSGGHTIGISHCSSFTGRLYPTQDTTMDQTFAKNLKQVCPTANSSNTTVLDIRTPNKFDNKYYVDLMNRQGLFTSDQDLYTNSRTRGIVTSFAVNQTLFFEKFVAAMVKMSQLSVLTGKAGEIRANCSVRNANNNSLLASVVEEEARSEY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 1 EST.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTAATTTCTC TTTTCATATT TATTCCTTTC ATTTCTATTC AGACATACAA TTCATTTATG GTTTCAATAA GCTAGAGGAG GGACCGATTG AACATATGTA GTTGAGGATC AAATGATTTA  TAATTAAGTT CTGGCTTTTC TCCTATTAAT TATAAACTCA TTTAGTCACA AAGTCATTCC ATTATAGTAT CGTGACTGAG CTCTTCCCAA CGACATACCA TTACGAAAGC AACTATTCAG  TGCTCGTCCA ATGACCTTGT CATAAGTGTG TTACCTTCAT ATGATATCCT TGATCTCTTT TAGATAATAT CTATTCTCCC AATATGATCC TATTTTATCT CATGGGAACA ATTACATATT  CCTTCATGGA AAGTCAATCA CTATCAAATA GTGATCAAGT CATCCATCAC AAATACGGAC GACCCGTGAC CACATTTACT TTTCATCAAC CATGTAATGT CAATGAGAGG ATATCATTTA  CCTGTGTTTT GAGTTATGAA TTCCACTATT GTGAATGACG TTACATACTA CAAAAGTTGT ACATCCAATG CACCAACTTT CGGTTCCTTA TCTATTTGAA CTCAGACTTT TACTTACATC  AAAGTGTACA AGTCACGCAT ACATAGTCTG TCGTCTACTC AGGATTTAGG TATGCCACAC TATGAACATC ATAAGTGAAT AAATCCATAA ACGAATTTAG GATCTATTCT GCTTAGGTTA  TGTCTGATGT ACTATCAATC CAGTCAGCCA GTCAGTCACA TCTTTGTCTC TATCTTTTGG AAGTCATTCG CTCTGATGCC TAAGACAAGA CATCTCCCAA TTGGACTTGA TAGACGACAT  ATTAGTCTTT CAATTAGTTT TCTCATTCCC GATTAGACTA AGGACATATT TAGGTTCATC TACTAATACA AGCTGTCTTT CCGTACTACG ATCCAACCAT GTAATACCGC TTAGCATCAG  TTTAAACAAT AGACAACCAA TGAGCGACAT TTTCTTCTAT TTTGCTTTAC GTGCAAAAAT CATTTCAGGA AAATAATACA ATGTATATTA ATGTAATTTA TGAATAATTT TATTAACTAA  TCTGCTCGAA AAAATTACAA GTGAACTTAG ATGAAAATAC TACACTTAGG GCACCAGATC TAACATATCA AAGTATACAA GTCACACATA CATAGCTAAT CGTCCACTCA AGATTAATGT  ATACCATACT ATGAATGTCA CAAGTGAATA AATCCATAAA CGAATCTAAG ATCTATTCTA TTTGGGTCCT ATCTGTTATA CTGTCAGTAT AGTTAGTCAC GTCTATGTCT TTATCTTTTA  GGAGTTTTTC GTTCTAATAC TTAAGACAAG ATATCTCCCT ATGAGACTAG ATAGATGACA TATTAGTCTT TCAAATTGGT TTGCTTATTT CCGATTAAAA TTAAAAAATA TGTTTAGATT  ATCTACTAAT ATAAGTTGTC TTTCTGTAAT ATGATCCGAC TACATAATAC CTCTTAGTAT TAATTAAACG TTAGATAACC AATGAGCCAA TATTTGCTTC CATTTTGCTT TGTGCACAAA  AAACGGTTGA GAATAATATA CAAAAGATAT TAATGTAATT AATTGATATT TTATTAAACT AATTTATTTG AAAAACACAA GTATACAAAG ACGAAAATAT TACACTAAGA GCACTATATC  TAACAAAATA ATATTCCAGT AGATGGAATG TTGAGCTGGT TGGTCCTAAA GAACAACCCA TTTCACTTAC TTATCAATCA ATTTTTCATT GCATCCAAAT AAGGTTCTTT TTATAACTGA  TATGATCCGA GATATTCTAA ATATTATTTT AGGTATAAAT CATTCTAGTA AAATCGATTT TGGCTGAAAA ATTTAAAATT TGTTCTAAAA TTGTCTTAAT TTGGTAATTT GTTATTTTTT  AATAGCATTT GGGTAAAAAA AAAATCCTAC TATTATGTTA CTGATAAGGG AAAATGTGTT CACCACATGC CATTTCCTAT TTCATTGATT ATTCTCCTAT TTATAGAAAG AATAAAGGTC  TTTGTCAAAA TGTTTTCTTT TTTATTCTTC TTTTAAATCT TTACCTTGGA CACGCGTGAA GAAAAGGGGA GATATGTGGA AAATAGAAAT AAAGAGATAA AGAATGGGTT GCTCAGGCTA 
TAAATCAGAC TGTTGTGGTC TATCCGAAAC ACAAGAAACA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTAAAGCTACATCTTTTACTGCTTTCCTTTTGATGTCTTCTCTATTTCTTTCTTCTCACTTTTCTGTCTCAAAAGCAGACAACTCCGCTCCCATAGTGAGTGGTCTCTCATGGACTT
TCTACAAAACTTCATGTCCCAAAGTAGAATCCATTATTAGAAAACAACTGCAGAAGGTTTTCAAGAAGGACATAGGCCAAGCTGCTGGCTTGCTCCGTCTTCATTTCCATGACTGCTTTG
TTCAG
GTGCCGGTTAATTAATATGCAAACACAGAGTCTCTTGGAGTAATAGTTATTGTATTCTGAATATTCTTCTTCCTAGAGTATTCTGAATATTACTCACAGCTTGAGTTACAACTAA
AAGAAGAAATATTGCTTCAAATCCTACCATTTTCAGTTTTCACTAACAAGAATCTGCTTCATTAAAAGACACTTTAATGTGGCTACAGTGAGTTGGTGAATTTTTAATGGAAAATTGAAT
ATGATCAGGTCATGATTTATATATAATAATAATGAATAAATATTGCAGGGATGTGATGCATCGGTGCTGCTGGATGGATCAGCGAGTGGACCAAGCGAGCAGGATGCTCCGCCGAACCTG
ACCTTGAGAGGATTCGAAATCATCAATGACCTGCGTGCGCGTGTCCACAAGGAGTGTGGAAGAGTCGTCTCTTGTGCTGATATCGCTGCTCTTGCTGCTCGTGACTCTGTTTACCTG
GTA
TATTCTTTTACCACTCAATTTTCTTAAATATTTAAATTACTTCAACTTATTTGATTCTTCGAGTCAAGTTTAGTATTAATTAAACATAATAAATAATGATTTTTTTTTAGAGATATATGG
TAATGAAATTAGAAAATATTAGCTAACAATTAAATTTAAATATTAATATCGATTGAGTATTAATTTAATGGGAGTTTCAACGCTCTAAAAATACTTTTATATTCTATTTAAAAGTGAAAA
GAGGTTATATATTAGGTAAAATAAAATTATATATTTTAGTTAAAAGATTTATGATTTGAATATGGTATTTCAATTTACTGATTTATGGGTCTACTTCATATTAGAAATTGAAAGTTCAAA
GGAAGGAAAAGTCAGCTTTTTGGTGCGATAAAGCTTAAATTTCTTAAAGATTAGAGTATGGAATAAATATATTTGTTAGTTTATTTAATTTTTAATACGTTTTCTACATATCCCATACTT
AAAAAAAAGGAATCATCATTAACAAGGGTGATAACCATAATGAAAAATTTTAAATAATTCCAGTCATTCCATTAAAAGATACCCATTTTAAATCATAAAATTATAGATATTATCAAGTGA
AAAATCAATAGTAATTTTTACATTAGAAAGAAGAAAAAAAATCTTATTAATTACAATTTGAATTAATTTAAAATAAAAGTAACAATGTTTTTCTAATAAAATTATTAACAATTAAGAAAT
TGAAAAAAATGACGAATCCATATTAAAATGCGACAAATCCGATGAACCTGCTAAGTGCTAATGCCGATTAGAAAATATAAAATTATGATTCTTTATTTCTTATTCCACTCCCCAAATTTC
ATTATTACTCCCCAGCTTTGCTTTTATAAAACTTTCTAATTGCAACAACGAGTGGGATTGGTGGTTAAATTATATTATATTTGATAAATTTAAAAAACAGTAATTATTGAAAAACTAAAT
GTTAAAAAATAAATATTAAAAAATTGAGTGTTGAATTTAAATTATAAAATATTTTTAGTATTTTATTTAAAATTAAATATAAAATATAATTAAATTATTTGTTAAAAGATAAATATAATC
ATAAATGAAATAAAGTAAGATAAAATAAAAAATTATTAAATATTGGCTATTAAGTGATGCCTATCTTTTTATTATCTTCTATACTTCTTTTTTTTTTAGAAAAATTCTATATAATAGTTT
TCATTATGTGTTACCAAACCTGTTTAAAAAATTAAGTTGCTTAAAAAACTAATTTTTAGTTGATTGAGTTTTTTCAATAGTGCCTTGAATTTTTTTTAACACTTTATCAAACATTACATG
TACGAGTTTATAATTTTTTTAATAAATTTTATAAATTTATAAGAATTAATTTTAAATATATTATTTTATAATTAAAAAAAATGTTAAAAAGTGATATTTAAAGGTTAAGTAAATAGGTAA
AACTTTCAAAGCTAAAGTTCAAAAATGGTTGGAGGTTAGGTTTATTTTTTGATAAATAGATAAATGATTTGATTTAAAAGATTTTCCTTTTTTGCTTACCGCAATTAAAGAAACTTCTGC
ATAAACTTGTTATATTCACAAAATTATTAAATTAAATTAGATTTGTTTATACAAATCATGCATTGTCCCAACAAAATCTCCTACTAAATTTTGATTGAATATGGTAAATCGAATTAGACT
CTAAAAGAAGATAAACTCTCCTATTTTCTTTCAATTCAAAATGTTATATAAAAGAAATCGAATTTCATTCTAGGGAGCTCATAGATTACCTTCAATCACAACGCTCTAATGATTTTTTCT
TGATTGCTGCAGTCTGGAGGTCCGGACTATGACGTGCCATTGGGAAGGCGGGATGGACTGAGCTTCGCCACAAGAAATGCTACATTGCAGAACTTGCCCGCACCCTTCGCCAATGCTACC
GCCATCCTCTCCAGTCTCGCTACCAAAAACTTTGACCCCACAGATGTTGTGGCTCTCTCTGGTGGCCACACCATCGGCATCAGCCATTGCAGCTCTTTCACTGGCCGCCTTTACCCTACT
CAAGACACCACCATGGATCAAACCTTTGCCAAAAACCTCAAGCAAGTTTGTCCTACTGCAAATTCTTCAAACACCACGGTGTTAGATATAAGGACCCCTAACAAATTCGATAACAAGTAT
TACGTTGATCTCATGAACCGCCAGGGTCTTTTCACCTCCGACCAAGACTTGTACACAAATAGTAGGACCAGGGGCATTGTTACTAGCTTTGCTGTTAACCAGACTCTCTTCTTTGAGAAG
TTTGTGGCGGCCATGGTAAAGATGAGTCAGTTGAGTGTCTTGACAGGCAAGGCCGGTGAAATTCGTGCCAATTGCTCCGTAAGGAATGCCAATAACAACTCCCTCTTAGCGTCTGTGGTG
GAAGAGGAAGCTAGGTCTGAATATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTAAAGCTACATCTTTTACTGCTTTCCTTTTGATGTCTTCTCTATTTCTTTCTTCTCACTTTTCTGTCTCAAAAGCAGACAACTCCGCTCCCATAGTGAGTGGTCTCTCATGGACTT
TCTACAAAACTTCATGTCCCAAAGTAGAATCCATTATTAGAAAACAACTGCAGAAGGTTTTCAAGAAGGACATAGGCCAAGCTGCTGGCTTGCTCCGTCTTCATTTCCATGACTGCTTTG
TTCAG
GGATGTGATGCATCGGTGCTGCTGGATGGATCAGCGAGTGGACCAAGCGAGCAGGATGCTCCGCCGAACCTGACCTTGAGAGGATTCGAAATCATCAATGACCTGCGTGCGCGTG
TCCACAAGGAGTGTGGAAGAGTCGTCTCTTGTGCTGATATCGCTGCTCTTGCTGCTCGTGACTCTGTTTACCTG
TCTGGAGGTCCGGACTATGACGTGCCATTGGGAAGGCGGGATGGAC
TGAGCTTCGCCACAAGAAATGCTACATTGCAGAACTTGCCCGCACCCTTCGCCAATGCTACCGCCATCCTCTCCAGTCTCGCTACCAAAAACTTTGACCCCACAGATGTTGTGGCTCTCT
CTGGTGGCCACACCATCGGCATCAGCCATTGCAGCTCTTTCACTGGCCGCCTTTACCCTACTCAAGACACCACCATGGATCAAACCTTTGCCAAAAACCTCAAGCAAGTTTGTCCTACTG
CAAATTCTTCAAACACCACGGTGTTAGATATAAGGACCCCTAACAAATTCGATAACAAGTATTACGTTGATCTCATGAACCGCCAGGGTCTTTTCACCTCCGACCAAGACTTGTACACAA
ATAGTAGGACCAGGGGCATTGTTACTAGCTTTGCTGTTAACCAGACTCTCTTCTTTGAGAAGTTTGTGGCGGCCATGGTAAAGATGAGTCAGTTGAGTGTCTTGACAGGCAAGGCCGGTG
AAATTCGTGCCAATTGCTCCGTAAGGAATGCCAATAACAACTCCCTCTTAGCGTCTGTGGTGGAAGAGGAAGCTAGGTCTGAATATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGTTGCTCA GGCTATAAAT CAGACTGTTG TGGTCTATCC GAAACACAAG AAACAACAAG TAGGCATGGC TAAAGCTACA TCTTTTACTG CTTTCCTTTT GATGTCTTCT CTATTTCTTT  CTTCTCACTT TTCTGTCTCA AAAGCAGACA ACTCCGCTCC CATAGTGAGT GGTCTCTCAT GGACTTTCTA CAAAACTTCA TGTCCCAAAG TAGAATCCAT TATTAGAAAA CAACTGCAGA  AGGTTTTCAA GAAGGACATA GGCCAAGCTG CTGGCTTGCT CCGTCTTCAT TTCCATGACT GCTTTGTTCA GGGATGTGAT GCATCGGTGC TGCTGGATGG ATCAGCGAGT GGACCAAGCG  AGCAGGATGC TCCGCCGAAC CTGACCTTGA GAGGATTCGA AATCATCAAT GACCTGCGTG CGCGTGTCCA CAAGGAGTGT GGAAGAGTCG TCTCTTGTGC TGATATCGCT GCTCTTGCTG  CTCGTGACTC TGTTTACCTG TCTGGAGGTC CGGACTATGA CGTGCCATTG GGAAGGCGGG ATGGACTGAG CTTCGCCACA AGAAATGCTA CATTGCAGAA CTTGCCCGCA CCCTTCGCCA  ATGCTACCGC CATCCTCTCC AGTCTCGCTA CCAAAAACTT TGACCCCACA GATGTTGTGG CTCTCTCTGG TGGCCACACC ATCGGCATCA GCCATTGCAG CTCTTTCACT GGCCGCCTTT  ACCCTACTCA AGACACCACC ATGGATCAAA CCTTTGCCAA AAACCTCAAG CAAGTTTGTC CTACTGCAAA TTCTTCAAAC ACCACGGTGT TAGATATAAG GACCCCTAAC AAATTCGATA  ACAAGTATTA CGTTGATCTC ATGAACCGCC AGGGTCTTTT CACCTCCGAC CAAGACTTGT ACACAAATAG TAGGACCAGG GGCATTGTTA CTAGCTTTGC TGTTAACCAG ACTCTCTTCT  TTGAGAAGTT TGTGGCGGCC ATGGTAAAGA TGAGTCAGTT GAGTGTCTTG ACAGGCAAGG CCGGTGAAAT TCGTGCCAAT TGCTCCGTAA GGAATGCCAA TAACAACTCC CTCTTAGCGT  CTGTGGTGGA AGAGGAAGCT AGGTCTGAAT ATTAAGGACT TAACATCTTA ACTATGTTTT TGTATCACAT CTTTTCTTTG TCGGTGTATT TGCTTGCTTA AGTTGGGGTG ACGGGGTTTG  TATCCAGTGT TAACTTTTAA TAAAAGTATC CAAACTTTGA TGAAAACCAG ACCAAGTCTG AAATCAACCA GACAAGGAGC TTTACAAATT AGAGCTCAAG TTAATAATAT CAGCCATGGG 
ATTAGCTT 

Retrieve as FASTA