Entry information : AeuRboh02_Ae201684 (Ae201684_13024.1)
Entry ID 12900
Creation 2014-03-26 (Catherine Mathe)
Last sequence changes 2014-03-26 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-27 (Christophe Dunand)
Peroxidase information: AeuRboh02_Ae201684 (Ae201684_13024.1)
Name (synonym) AeuRboh02_Ae201684 (Ae201684_13024.1)
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh008]
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AeuRboh02_Ae201684
start..stop
S start..stop
PraRboh03 526 8.86e-180 70..695 14..677
PiRboh03 511 7.2e-174 56..695 2..676
PiRboh02 468 1.32e-156 46..695 58..704
PiRboh04 464 8.26e-156 68..695 9..659
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12900' 'join(245919..247031,247076..247282,247330..248097)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 245919..247031 1111 N° 2 247076..247282 205 N° 3 247330..248097 766  
join(245919..247031,247076..247282,247330..248097)


exon

Literature and cross-references AeuRboh02_Ae201684 (Ae201684_13024.1)
Protein sequence: AeuRboh02_Ae201684 (Ae201684_13024.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   695
PWM (Da):   %s   78280.3 Transmb domain:   %s   i190-209o224-246i266-288o321-343i356-378o
PI (pH):   %s   9.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTRSSKLTDWHNSLQHHGPGASYASSSYYLASSNDDDSSGRMLADHTSSIELKLLDVCVATTRETNADKRLRAVFDLFDVDQTGRLTPAGLQAFLASTMAKHNVTLCGVELHEIVQQA
FEAANLRGMNSNQEKALTFADFKLLFQDTLDPRKSVASARGRPSQPAVIRRSKVDKFFSGFVRYQTELQFLALYTLINVAAFWLKWISFPYDVVAGYMAKLAKSCAQLVLLNSMLVLLPM
CRSVVGTLRGFRVLWYIFPFDHNIVFHQIAAVVILVAGIVHTAAWIAIVVQAKHATEAEWTASILNKAKTQIVRYGAILDLVATIPIWTGVAMLLCAGFAIPFTFQRVRRWNFNYFWLTH
MLFIPFLVFLCIHGAAAWVAPPQAWFWVVGPLALYFIERRFRVTTVFQSQTKLKKVHVMSSAMVLYMKKPRGFRSFTPGMYLFLKVPELSAYEWHPFTISSAPEDSMLSLHVRVAGDWTS
ALHARLQKPGPLPAIAIDGPVGAPSIEYSNYSTVVLIGGGIGVTPFASILKHLLHVWEEHRCPDCGSVQLPARIKLRKVHFYWVTKEQHCMVWFRDMLNQLSEIDSDGRLSIQTYLTNLS
NANASAPLRLIQTFMQNHNERDIFTGLQRSKMHMGRPDWDAEFSRIARAANGEQEEIGVFLCGPPALDKDVNAKCNQYNVKHPEGVHYSYHSEKF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
scaffold35:245919..248097
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGACAAGGTCTTCGAAATTGACCGACTGGCACAACTCGCTCCAACACCACGGGCCAGGAGCCAGCTATGCGTCGTCGTCGTACTATTTGGCCTCGTCCAACGACGACGACTCG
AGCGGCCGCATGTTGGCCGACCACACGTCGTCCATTGAGCTCAAATTACTCGACGTCTGCGTGGCCACGACGCGGGAAACCAACGCGGACAAGCGGCTCCGAGCGGTGTTTGACCTCTTT
GACGTCGACCAGACCGGTCGGCTCACCCCGGCCGGGCTCCAAGCCTTCCTCGCCAGCACCATGGCCAAGCATAACGTCACGCTCTGCGGCGTTGAGCTCCACGAGATTGTCCAGCAAGCG
TTTGAAGCCGCCAACCTCCGCGGCATGAACAGCAACCAAGAAAAGGCGCTCACGTTCGCCGACTTTAAGCTTCTCTTCCAAGACACACTCGATCCACGCAAGAGCGTCGCGAGCGCGCGC
GGCCGGCCGTCCCAACCCGCCGTCATCCGTCGCTCCAAAGTCGACAAGTTCTTCTCGGGCTTTGTGCGCTACCAGACGGAGCTCCAGTTCCTCGCGCTCTACACGCTCATCAACGTCGCG
GCGTTTTGGCTCAAGTGGATCAGCTTTCCGTACGATGTCGTCGCGGGGTACATGGCCAAACTCGCCAAGTCGTGCGCGCAGCTCGTGCTCCTCAACTCGATGCTCGTGCTGCTTCCCATG
TGTCGCTCAGTCGTCGGCACGCTGCGTGGTTTCCGCGTCCTCTGGTACATCTTTCCCTTTGACCACAACATTGTCTTCCATCAAATCGCCGCCGTCGTGATTCTCGTCGCGGGGATTGTC
CACACCGCGGCGTGGATCGCGATCGTCGTCCAGGCCAAGCATGCGACGGAAGCCGAGTGGACGGCATCGATCCTCAACAAGGCCAAGACGCAGATCGTTCGGTATGGCGCGATCCTCGAC
TTGGTGGCGACGATTCCCATCTGGACGGGCGTCGCCATGCTTCTCTGCGCCGGCTTTGCGATTCCGTTCACCTTCCAGCGCGTCCGTCGGTGGAATTTCAACTACTTTTGGCTCACGCAC
ATGCTCTTCATACCATTCCTCGTCTTCCTCTGC
GCGTACGCGCTCTCCCATCCTTGCTTGGTTGCTCATCTTCGTGTAGATCCACGGCGCGGCAGCATGGGTAGCGCCACCTCAAGCTTG
GTTCTGGGTCGTCGGGCCACTGGCTCTCTACTTTATCGAGCGCCGCTTCCGCGTCACGACGGTCTTCCAAAGCCAAACCAAGCTCAAGAAAGTCCACGTCATGTCGTCCGCCATGGTGTT
GTACATGAAGAAACCCCGCGGGTTCCGCAGCTTCACGCCTGGCATG
TGGTACGTCCGATTGCCGCCGATGTGGCGCTAAGTCCGCTTTTCTCTAGTATTTGTTCCTCAAAGTGCCCGAAC
TCTCTGCGTACGAATGGCATCCGTTCACGATCTCGTCGGCGCCTGAAGACAGCATGCTCTCGCTGCATGTCCGCGTCGCTGGGGACTGGACGTCGGCTCTCCATGCGCGTCTCCAGAAGC
CTGGTCCTCTCCCTGCGATTGCGATCGATGGCCCCGTAGGTGCGCCGTCGATTGAATACTCCAACTACTCGACGGTCGTCTTGATCGGCGGCGGCATCGGCGTCACTCCCTTCGCGTCCA
TCCTCAAGCATTTGCTCCACGTGTGGGAAGAGCATCGCTGCCCGGACTGCGGCTCGGTCCAGCTCCCCGCGCGCATCAAACTGCGCAAAGTCCACTTCTACTGGGTCACCAAGGAGCAGC
ACTGCATGGTGTGGTTCCGCGACATGCTCAACCAACTGAGCGAGATCGACAGCGATGGCCGCCTCTCCATCCAAACCTATTTGACCAACCTCAGCAACGCCAACGCGTCGGCGCCGCTCC
GGCTCATCCAGACATTCATGCAGAACCACAACGAGCGCGACATCTTTACAGGCTTGCAGCGCTCCAAGATGCACATGGGACGGCCCGACTGGGACGCCGAGTTCAGTCGCATCGCGCGCG
CCGCCAATGGAGAGCAGGAAGAAATCGGCGTCTTCCTATGCGGCCCGCCGGCGCTCGACAAAGACGTCAATGCGAAATGCAACCAGTACAACGTCAAACATCCCGAGGGGGTCCATTACA
GCTACCATTCCGAGAAGTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGACAAGGTCTTCGAAATTGACCGACTGGCACAACTCGCTCCAACACCACGGGCCAGGAGCCAGCTATGCGTCGTCGTCGTACTATTTGGCCTCGTCCAACGACGACGACTCG
AGCGGCCGCATGTTGGCCGACCACACGTCGTCCATTGAGCTCAAATTACTCGACGTCTGCGTGGCCACGACGCGGGAAACCAACGCGGACAAGCGGCTCCGAGCGGTGTTTGACCTCTTT
GACGTCGACCAGACCGGTCGGCTCACCCCGGCCGGGCTCCAAGCCTTCCTCGCCAGCACCATGGCCAAGCATAACGTCACGCTCTGCGGCGTTGAGCTCCACGAGATTGTCCAGCAAGCG
TTTGAAGCCGCCAACCTCCGCGGCATGAACAGCAACCAAGAAAAGGCGCTCACGTTCGCCGACTTTAAGCTTCTCTTCCAAGACACACTCGATCCACGCAAGAGCGTCGCGAGCGCGCGC
GGCCGGCCGTCCCAACCCGCCGTCATCCGTCGCTCCAAAGTCGACAAGTTCTTCTCGGGCTTTGTGCGCTACCAGACGGAGCTCCAGTTCCTCGCGCTCTACACGCTCATCAACGTCGCG
GCGTTTTGGCTCAAGTGGATCAGCTTTCCGTACGATGTCGTCGCGGGGTACATGGCCAAACTCGCCAAGTCGTGCGCGCAGCTCGTGCTCCTCAACTCGATGCTCGTGCTGCTTCCCATG
TGTCGCTCAGTCGTCGGCACGCTGCGTGGTTTCCGCGTCCTCTGGTACATCTTTCCCTTTGACCACAACATTGTCTTCCATCAAATCGCCGCCGTCGTGATTCTCGTCGCGGGGATTGTC
CACACCGCGGCGTGGATCGCGATCGTCGTCCAGGCCAAGCATGCGACGGAAGCCGAGTGGACGGCATCGATCCTCAACAAGGCCAAGACGCAGATCGTTCGGTATGGCGCGATCCTCGAC
TTGGTGGCGACGATTCCCATCTGGACGGGCGTCGCCATGCTTCTCTGCGCCGGCTTTGCGATTCCGTTCACCTTCCAGCGCGTCCGTCGGTGGAATTTCAACTACTTTTGGCTCACGCAC
ATGCTCTTCATACCATTCCTCGTCTTCCTCTGC
ATCCACGGCGCGGCAGCATGGGTAGCGCCACCTCAAGCTTGGTTCTGGGTCGTCGGGCCACTGGCTCTCTACTTTATCGAGCGCCGC
TTCCGCGTCACGACGGTCTTCCAAAGCCAAACCAAGCTCAAGAAAGTCCACGTCATGTCGTCCGCCATGGTGTTGTACATGAAGAAACCCCGCGGGTTCCGCAGCTTCACGCCTGGCATG
TATTTGTTCCTCAAAGTGCCCGAACTCTCTGCGTACGAATGGCATCCGTTCACGATCTCGTCGGCGCCTGAAGACAGCATGCTCTCGCTGCATGTCCGCGTCGCTGGGGACTGGACGTCG
GCTCTCCATGCGCGTCTCCAGAAGCCTGGTCCTCTCCCTGCGATTGCGATCGATGGCCCCGTAGGTGCGCCGTCGATTGAATACTCCAACTACTCGACGGTCGTCTTGATCGGCGGCGGC
ATCGGCGTCACTCCCTTCGCGTCCATCCTCAAGCATTTGCTCCACGTGTGGGAAGAGCATCGCTGCCCGGACTGCGGCTCGGTCCAGCTCCCCGCGCGCATCAAACTGCGCAAAGTCCAC
TTCTACTGGGTCACCAAGGAGCAGCACTGCATGGTGTGGTTCCGCGACATGCTCAACCAACTGAGCGAGATCGACAGCGATGGCCGCCTCTCCATCCAAACCTATTTGACCAACCTCAGC
AACGCCAACGCGTCGGCGCCGCTCCGGCTCATCCAGACATTCATGCAGAACCACAACGAGCGCGACATCTTTACAGGCTTGCAGCGCTCCAAGATGCACATGGGACGGCCCGACTGGGAC
GCCGAGTTCAGTCGCATCGCGCGCGCCGCCAATGGAGAGCAGGAAGAAATCGGCGTCTTCCTATGCGGCCCGCCGGCGCTCGACAAAGACGTCAATGCGAAATGCAACCAGTACAACGTC
AAACATCCCGAGGGGGTCCATTACAGCTACCATTCCGAGAAGTTCTAA

Retrieve as FASTA